KEGG   Homo sapiens (human): 55
Entry
55                CDS       T01001                                 

Gene name
ACP3, 5'-NT, ACP-3, ACPP, TM-PAP
Definition
(RefSeq) acid phosphatase 3
  KO
K19283  prostatic aicd phosphatase [EC:3.1.3.2 3.1.3.5]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    55 (ACP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     55 (ACP3)
    3.1.3.5  5'-nucleotidase
     55 (ACP3)
SSDB
Motif
Pfam: His_Phos_2
Other DBs
NCBI-GeneID: 55
NCBI-ProteinID: NP_001090
OMIM: 171790
HGNC: 125
Ensembl: ENSG00000014257
Vega: OTTHUMG00000159650
Pharos: P15309(Tchem)
UniProt: P15309
Structure
PDB: 

Position
3q22.1
AA seq 386 aa
MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKE
SSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNL
AALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKR
LHPYKDFIATLGKLSGLHGQDLFGIWSKVYDPLYCESVHNFTLPSWATEDTMTKLRELSE
LSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMYSAHDTTVSGLQMAL
DVYNGLLPPYASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELV
GPVIPQDWSTECMTTNSHQGTEDSTD
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgagagctgcacccctcctcctggccagggcagcaagccttagccttggcttcttgttt
ctgctttttttctggctagaccgaagtgtactagccaaggagttgaagtttgtgactttg
gtgtttcggcatggagaccgaagtcccattgacacctttcccactgaccccataaaggaa
tcctcatggccacaaggatttggccaactcacccagctgggcatggagcagcattatgaa
cttggagagtatataagaaagagatatagaaaattcttgaatgagtcctataaacatgaa
caggtttatattcgaagcacagacgttgaccggactttgatgagtgctatgacaaacctg
gcagccctgtttcccccagaaggtgtcagcatctggaatcctatcctactctggcagccc
atcccggtgcacacagttcctctttctgaagatcagttgctatacctgcctttcaggaac
tgccctcgttttcaagaacttgagagtgagactttgaaatcagaggaattccagaagagg
ctgcacccttataaggattttatagctaccttgggaaaactttcaggattacatggccag
gacctttttggaatttggagtaaagtctacgaccctttatattgtgagagtgttcacaat
ttcactttaccctcctgggccactgaggacaccatgactaagttgagagaattgtcagaa
ttgtccctcctgtccctctatggaattcacaagcagaaagagaaatctaggctccaaggg
ggtgtcctggtcaatgaaatcctcaatcacatgaagagagcaactcagataccaagctac
aaaaaactcatcatgtattctgcgcatgacactactgtgagtggcctacagatggcgcta
gatgtttacaacggactccttcctccctatgcttcttgccacttgacggaattgtacttt
gagaagggggagtactttgtggagatgtactatcggaatgagacgcagcacgagccgtat
cccctcatgctacctggctgcagccccagctgtcctctggagaggtttgctgagctggtt
ggccctgtgatccctcaagactggtccacggagtgtatgaccacaaacagccatcaaggt
actgaagacagtacagattag

DBGET integrated database retrieval system