KEGG   Homo sapiens (human): 550
Entry
550               CDS       T01001                                 
Symbol
AUP1
Name
(RefSeq) AUP1 lipid droplet regulating VLDL assembly factor
  KO
K19716  ancient ubiquitous protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99993 Cell motility
    550 (AUP1)
SSDB
Motif
Pfam: CUE
Other DBs
NCBI-GeneID: 550
NCBI-ProteinID: NP_853553
OMIM: 602434
HGNC: 891
Ensembl: ENSG00000115307
Pharos: Q9Y679(Tbio)
UniProt: Q9Y679
Structure
Position
2:complement(74526652..74529706)
AA seq 410 aa
MELPSGPGPERLFDSHRLPGDCFLLLVLLLYAPVGFCLLVLRLFLGIHVFLVSCALPDSV
LRRFVVRTMCAVLGLVARQEDSGLRDHSVRVLISNHVTPFDHNIVNLLTTCSTPLLNSPP
SFVCWSRGFMEMNGRGELVESLKRFCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFS
IQDVVQPLTLQVQRPLVSVTVSDASWVSELLWSLFVPFTVYQVRWLRPVHRQLGEANEEF
ALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATL
AQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPTASASKF
PSSGPVTPQPTALTFAKSSWARQESLQERKQALYEYARRRFTERRAQEAD
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggagcttccctcagggccggggccggagcggctctttgactcgcaccggcttccgggt
gactgcttcctactgctcgtgctgctgctctacgcgccagtcgggttctgcctcctcgtc
ctgcgcctctttctcgggatccacgtcttcctggtcagctgcgcgctgccagacagcgtc
cttcgcagattcgtagtgcggaccatgtgtgcggtgctagggctcgtggcccggcaggag
gactccggactccgggatcacagtgtcagggtcctcatttccaaccatgtgacacctttc
gaccacaacatagtcaatttgcttaccacctgtagcacccctctactcaatagtcccccc
agctttgtgtgctggtctcggggcttcatggagatgaatgggcggggggagttggtggag
tcactcaagagattctgtgcttccacgaggcttccccccactcctctgctgctattccct
gaggaagaggccaccaatggccgggaggggctcctgcgcttcagttcctggccattttct
atccaagatgtggtacaacctcttaccctgcaagttcagagacccctggtctctgtgacg
gtgtcagatgcctcctgggtctcagaactgctgtggtcacttttcgtccctttcacggtg
tatcaagtaaggtggcttcgtcctgttcatcgccaactaggggaagcgaatgaggagttt
gcactccgtgtacaacagctggtggccaaggaattgggccagacagggacacggctcact
ccagctgacaaagcagagcacatgaagcgacaaagacaccccagattgcgcccccagtca
gcccagtcttctttccctccctcccctggtccttctcctgatgtgcaactggcaactctg
gctcagagagtcaaggaagttttgccccatgtgccattgggtgtcatccagagagacctg
gccaagactggctgtgtagacttgactatcactaatctgcttgagggggccgtagctttc
atgcctgaagacatcaccaagggaactcagtccctacccacagcctctgcctccaagttt
cccagctctggcccggtgacccctcagccaacagccctaacatttgccaagtcttcctgg
gcccggcaggagagcctgcaggagcgcaagcaagcactatatgaatacgcaagaaggaga
ttcacagagagacgagcccaggaggctgactga

DBGET integrated database retrieval system