KEGG   Homo sapiens (human): 5500Help
Entry
5500              CDS       T01001                                 

Gene name
PPP1CB, HEL-S-80p, NSLH2, PP-1B, PP1B, PP1beta, PPP1CD
Definition
(RefSeq) protein phosphatase 1 catalytic subunit beta
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04611  Platelet activation
hsa04720  Long-term potentiation
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04810  Regulation of actin cytoskeleton
hsa04910  Insulin signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04931  Insulin resistance
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05168  Herpes simplex infection
hsa05205  Proteoglycans in cancer
Disease
H00523  Noonan syndrome and related disorders
H02191  Noonan-like syndrome with loose anagen hair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5500 (PPP1CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    5500 (PPP1CB)
   04024 cAMP signaling pathway
    5500 (PPP1CB)
   04022 cGMP-PKG signaling pathway
    5500 (PPP1CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5500 (PPP1CB)
   04218 Cellular senescence
    5500 (PPP1CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5500 (PPP1CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5500 (PPP1CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5500 (PPP1CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5500 (PPP1CB)
   04921 Oxytocin signaling pathway
    5500 (PPP1CB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5500 (PPP1CB)
   04270 Vascular smooth muscle contraction
    5500 (PPP1CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    5500 (PPP1CB)
   04720 Long-term potentiation
    5500 (PPP1CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5500 (PPP1CB)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    5500 (PPP1CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    5500 (PPP1CB)
   05034 Alcoholism
    5500 (PPP1CB)
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    5500 (PPP1CB)
  09172 Infectious diseases: Viral
   05168 Herpes simplex infection
    5500 (PPP1CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5500 (PPP1CB)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5500 (PPP1CB)
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5500 (PPP1CB)
   03041 Spliceosome [BR:hsa03041]
    5500 (PPP1CB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5500 (PPP1CB)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     5500 (PPP1CB)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     5500 (PPP1CB)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     5500 (PPP1CB)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    5500 (PPP1CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 5500
NCBI-ProteinID: NP_002700
OMIM: 600590
HGNC: 9282
Ensembl: ENSG00000213639
Vega: OTTHUMG00000152011
Pharos: P62140(Tbio)
UniProt: P62140 V9HW04
Structure
PDB: 

Position
2p23.2
AA seq 327 aa AA seqDB search
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcggacggggagctgaacgtggacagcctcatcacccggctgctggaggtacgagga
tgtcgtccaggaaagattgtgcagatgactgaagcagaagttcgaggcttatgtatcaag
tctcgggagatctttctcagccagcctattcttttggaattggaagcaccgctgaaaatt
tgtggagatattcatggacaatatacagatttactgagattatttgaatatggaggtttc
ccaccagaagccaactatcttttcttaggagattatgtggacagaggaaagcagtctttg
gaaaccatttgtttgctattggcttataaaatcaaatatccagagaacttctttctctta
agaggaaaccatgagtgtgctagcatcaatcgcatttatggattctatgatgaatgcaaa
cgaagatttaatattaaattgtggaagaccttcactgattgttttaactgtctgcctata
gcagccattgtggatgagaagatcttctgttgtcatggaggattgtcaccagacctgcaa
tctatggagcagattcggagaattatgagacctactgatgtccctgatacaggtttgctc
tgtgatttgctatggtctgatccagataaggatgtgcaaggctggggagaaaatgatcgt
ggtgtttcctttacttttggagctgatgtagtcagtaaatttctgaatcgtcatgattta
gatttgatttgtcgagctcatcaggtggtggaagatggatatgaattttttgctaaacga
cagttggtaaccttattttcagccccaaattactgtggcgagtttgataatgctggtgga
atgatgagtgtggatgaaactttgatgtgttcatttcagatattgaaaccatctgaaaag
aaagctaaataccagtatggtggactgaattctggacgtcctgtcactccacctcgaaca
gctaatccgccgaagaaaaggtga

DBGET integrated database retrieval system