KEGG   Homo sapiens (human): 55004
Entry
55004             CDS       T01001                                 

Gene name
LAMTOR1, C11orf59, PDRO, Ragulator1, p18, p27RF-Rho
Definition
(RefSeq) late endosomal/lysosomal adaptor, MAPK and MTOR activator 1
  KO
K20397  ragulator complex protein LAMTOR1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    55004 (LAMTOR1)
SSDB
Motif
Pfam: LAMTOR
Other DBs
NCBI-GeneID: 55004
NCBI-ProteinID: NP_060377
OMIM: 613510
HGNC: 26068
Ensembl: ENSG00000149357
Vega: OTTHUMG00000167869
Pharos: Q6IAA8(Tbio)
UniProt: Q6IAA8
Structure
PDB: 

Position
11q13.4
AA seq 161 aa
MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAK
TASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLA
SEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP
NT seq 486 nt   +upstreamnt  +downstreamnt
atggggtgctgctacagcagcgagaacgaggactcggaccaggaccgagaggagcggaag
ctgctgctggaccctagcagcccccctaccaaagctctcaatggagccgagcccaactac
cacagcctgccttccgctcgcactgatgagcaggccctgctctcttccatccttgccaag
acagccagcaacatcattgatgtgtctgctgcagactcacagggcatggagcagcatgag
tacatggaccgtgccaggcagtacagcacccgcttggctgtgctgagcagcagcctgacc
cattggaagaagctgccaccgctgccgtctcttaccagccagccccaccaagtgctggcc
agtgagcccatcccgttctctgatttgcagcaggtctccaggatagctgcttatgcctac
agtgcactttctcagatccgtgtggacgcaaaagaggagctggttgtacagtttgggatc
ccatga

DBGET integrated database retrieval system