KEGG   Homo sapiens (human): 55011
Entry
55011             CDS       T01001                                 

Gene name
PIH1D1, MOT48, NOP17, Pih1
Definition
(RefSeq) PIH1 domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: PIH1 PIH1_CS
Other DBs
NCBI-GeneID: 55011
NCBI-ProteinID: NP_060386
OMIM: 611480
HGNC: 26075
Ensembl: ENSG00000104872
Vega: OTTHUMG00000183167
Pharos: Q9NWS0(Tbio)
UniProt: Q9NWS0
Structure
PDB: 
4PSF 4PSI 6GXZ

Position
19q13.33
AA seq 290 aa
MANPKLLGMGLSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQPQPGFCIKTNS
SEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAY
DVAVNSDFYRRMQNSDFLRELVITIAREGLEDKYNLQLNPEWRMMKNRPFMGSISQQNIR
SEQRPRIQELGDLYTPAPGRAESGPEKPHLNLWLEAPDLLLAEVDLPKLDGALGLSLEIG
ENRLVMGGPQQLYHLDAYIPLQINSHESKAAFHRKRKQLMVAMPLLPVPS
NT seq 873 nt   +upstreamnt  +downstreamnt
atggcgaacccgaagctgctgggaatggggctaagcgaggcggaggcgatcggtgctgat
tcggcgcgatttgaggagctgctgctgcaggcctcgaaggagctccagcaagcccagaca
accagaccagaatcgacacaaatccagcctcagcctggtttctgcataaagaccaactcc
tcggaagggaaggttttcatcaacatctgccactccccctctatccctcctcccgccgac
gtgaccgaggaggagctgcttcagatgctagaggaggaccaagctgggtttcgcatcccc
atgagtctgggagagcctcatgcagaactggatgcaaaaggccagggatgtaccgcctac
gacgtagctgtcaacagcgacttctaccggaggatgcagaacagcgatttcttgcgggag
ctcgtgatcaccatcgccagggagggccttgaggacaaatacaacttgcagctgaatccg
gaatggcgcatgatgaagaaccggccattcatgggctccatctcgcagcagaacatccgc
tcggagcagcgtcctcggatccaggagctgggggacctgtacacgcccgcccccgggaga
gctgagtcagggcctgaaaagcctcacctgaacctgtggctggaagcccccgacctcctc
ttggccgaagttgacctccccaaactggatggagccctggggctgtcgctggagatcggg
gagaaccgcctggtgatggggggcccccagcagctgtatcatctagacgcttatatcccg
ctgcagatcaactctcatgagagcaaggcagccttccaccggaagagaaagcaattaatg
gtggccatgccgcttctgccggtgccttcttga

DBGET integrated database retrieval system