KEGG   Homo sapiens (human): 55017
Entry
55017             CDS       T01001                                 

Gene name
C14orf119
Definition
(RefSeq) chromosome 14 open reading frame 119
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4508
Other DBs
NCBI-GeneID: 55017
NCBI-ProteinID: NP_060394
HGNC: 20270
Ensembl: ENSG00000179933
Vega: OTTHUMG00000028717
Pharos: Q9NWQ9(Tdark)
UniProt: Q9NWQ9
Position
14q11.2
AA seq 140 aa
MPLESSSSMPLSFPSLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRERFLED
LVAKAVPEKLQPLLDSLEQLSVSGADRPPSIFECQLHLWDQWFRGWAEQERNEFVRQLEF
SEPDFVAKFYQAVAATAGKD
NT seq 423 nt   +upstreamnt  +downstreamnt
atgccactggagtcatcctcttcaatgccactatccttcccatctctcttaccctcagta
ccacacaatactaacccttcccctcctctgatgtcttacatcacctcccaggagatgaag
tgtattcttcactggtttgccaattggtcaggtccccagcgtgaacgtttcctagaggac
ctggtagctaaggcagtgccagaaaaattacaaccactgctggatagtctggagcagctt
agtgtgtctggggcagaccgaccaccttctatctttgagtgccagctacatctttgggat
cagtggtttcgaggctgggctgagcaggagcgcaatgaatttgtcagacagctggagttc
agtgagccagacttcgtggcaaagttttaccaagcagtggctgctacagctggtaaggac
tga

DBGET integrated database retrieval system