KEGG   Homo sapiens (human): 5502Help
Entry
5502              CDS       T01001                                 

Gene name
PPP1R1A, I1, IPP1
Definition
(RefSeq) protein phosphatase 1 regulatory inhibitor subunit 1A
  KO
K08050  protein phosphatase 1 regulatory subunit 1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04720  Long-term potentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5502 (PPP1R1A)
  09156 Nervous system
   04720 Long-term potentiation
    5502 (PPP1R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    5502 (PPP1R1A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5502 (PPP1R1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DARPP-32 RDM
Motif
Other DBs
NCBI-GeneID: 5502
NCBI-ProteinID: NP_006732
OMIM: 613246
HGNC: 9286
Ensembl: ENSG00000135447
Vega: OTTHUMG00000169934
Pharos: Q13522(Tbio)
UniProt: Q13522
Position
12q13.2
AA seq 171 aa AA seqDB search
MEQDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHL
KSTLAMSPRQRKKMTRITPTMKELQMMVEHHLGQQQQGEEPEGAAESTGTQESRPPGIPD
TEVESRLGTSGTAKKTAECIPKTHERGSKEPSTKEPSTHIPPLDSKGANSV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagacaacagcccccgaaagatccagttcacggtcccgctgctggagccgcac
cttgaccccgaggcggcggagcagattcggaggcgccgccccacccctgccaccctcgtg
ctgaccagtgaccagtcatccccagagatagatgaagaccggatccccaacccacatctc
aagtccactttggcaatgtctccacggcaacggaagaagatgacaaggatcacacccaca
atgaaagagctccagatgatggttgaacatcacctggggcaacagcagcaaggagaggaa
cctgagggggccgctgagagcacaggaacccaggagtcccgcccacctgggatcccagac
acagaagtggagtcaaggctgggcacctctgggacagcaaaaaaaactgcagaatgcatc
cctaaaactcacgagagaggcagtaaggaacccagcacaaaagaaccctcaacccatata
ccaccactggattccaagggagccaactcggtctga

DBGET integrated database retrieval system