KEGG   Homo sapiens (human): 55020
Entry
55020             CDS       T01001                                 
Symbol
TTC38, LL22NC03-5H6.5
Name
(RefSeq) tetratricopeptide repeat domain 38
  KO
K24942  tetratricopeptide repeat protein 38
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    55020 (TTC38)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  Tetratricopeptide repeat-containing proteins
   55020 (TTC38)
SSDB
Motif
Pfam: TPR_14 TPR_2 TPR_MalT TPR_1 Alkyl_sulf_dimr
Other DBs
NCBI-GeneID: 55020
NCBI-ProteinID: NP_060401
HGNC: 26082
Ensembl: ENSG00000075234
UniProt: Q5R3I4
Position
22:46268008..46294008
AA seq 469 aa
MAAASPLRDCQAWKDARLPLSTTSNEACKLFDATLTQYVKWTNDKSLGGIEGCLSKLKAA
DPTFVMGHAMATGLVLIGTGSSVKLDKELDLAVKTMVEISRTQPLTRREQLHVSAVETFA
NGNFPKACELWEQILQDHPTDMLALKFSHDAYFYLGYQEQMRDSVARIYPFWTPDIPLSS
YVKGIYSFGLMETNFYDQAEKLAKEALSINPTDAWSVHTVAHIHEMKAEIKDGLEFMQHS
ETFWKDSDMLACHNYWHWALYLIEKGEYEAALTIYDTHILPSLQANDAMLDVVDSCSMLY
RLQMEGVSVGQRWQDVLPVARKHSRDHILLFNDAHFLMASLGAHDPQTTQELLTTLRDAS
ESPGENCQHLLARDVGLPLCQALVEAEDGNPDRVLELLLPIRYRIVQLGGSNAQRDVFNQ
LLIHAALNCTSSVHKNVARSLLMERDALKPNSPLTERLIRKAATVHLMQ
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggccgcagcctcgcctctgcgcgactgccaggcctggaaggatgcgaggctcccgctc
tccaccacaagcaacgaagcctgcaagctgttcgatgccacgctgacccagtatgtaaaa
tggaccaatgacaagagtctcggtggcatcgagggctgcctgtcaaagctcaaagcagca
gatccaacctttgtgatgggccacgccatggctactggccttgtgctgattggcactgga
agctccgtgaagctggacaaagagctggacctggctgtgaagacaatggtggagatttca
agaacccagccgctgacaaggcgggagcagctgcacgtgtctgcagtagagacatttgcc
aatgggaactttccgaaagcctgtgaactatgggaacagattctccaggaccacccgaca
gacatgttggccctgaaattttcccatgatgcttatttttacctgggctatcaggaacag
atgagagattctgttgctcgaatttaccccttctggacacctgacatccccctaagcagc
tatgtgaaaggcatctactcttttggcttgatggaaaccaacttctacgaccaggcagaa
aaactcgccaaagaggctttatctattaacccgacagacgcatggtcggtgcacaccgtc
gctcacatccacgagatgaaagcagagatcaaggatgggttggaattcatgcagcactca
gagaccttctggaaggactctgatatgttggcttgtcataactattggcactgggcttta
tatctgattgagaagggcgaatatgaggccgcgctgaccatctacgatacccacatcctt
cccagcctgcaggccaacgatgcaatgctggacgtggtggacagctgctccatgctctac
cgcctgcagatggaaggagtgtctgtgggccagcggtggcaggatgtcctgcctgtggcc
cggaagcacagccgagaccacatcctgctgttcaatgacgcacacttcctgatggcatcc
ctgggtgcacacgacccccagaccacacaggagctgctgaccaccctgcgggacgccagc
gaatccccaggggagaactgccagcacctcctggcccgagacgtggggctgcccctgtgc
caggccctggtggaggctgaggacgggaaccctgaccgcgtcctggagctgctcctgccc
atccgctaccggatcgtccagctcggtgggagcaatgcccagagagacgtcttcaaccag
ctgctgattcacgcggccttaaactgcacctccagcgtccataagaacgtagcccggagc
cttctgatggagcgtgatgccttgaagcccaactcgcccctgaccgagcggctcatccgc
aaggcagctaccgtccacctcatgcagtga

DBGET integrated database retrieval system