KEGG   Homo sapiens (human): 55026Help
Entry
55026             CDS       T01001                                 

Gene name
TMEM255A, FAM70A
Definition
(RefSeq) transmembrane protein 255A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: FAM70 DUF4064 Phage_holin_3_2
Motif
Other DBs
NCBI-GeneID: 55026
NCBI-ProteinID: NP_060408
HGNC: 26086
Ensembl: ENSG00000125355
Vega: OTTHUMG00000022298
Pharos: Q5JRV8(Tdark)
UniProt: Q5JRV8 Q7Z4S8
Position
Xq24
AA seq 349 aa AA seqDB search
MHQSLTQQRSSDMSLPDSMGAFNRRKRNSIYVTVTLLIVSVLILTVGLAATTRTQNVTVG
GYYPGVILGFGSFLGIIGSNLIENKRQMLVASIVFISFGVIAAFCCAIVDGVFAARHIDL
KPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMRNLTQAAREVNCPHLSREFCTPRI
RGNTCFCCDLYNCGNRVEITGGYYEYIDVSSCQDIIHLYHLLWSATILNIVGLFLGIITA
AVLGGFKDMNPTLPALNCSVENTHPTVSYYAHPQVASYNTYYHSPPHLPPYSAYDFQHSG
VFPSSPPSGLSDEPQSASPSPSYMWSSSAPPRYSPPYYPPFEKPPPYSP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagtccctgactcagcagcggtccagcgacatgtccctgcccgattccatggga
gcattcaatcggaggaaacgaaactccatctatgtcaccgtgactttgcttattgtgtcc
gtgttaattctcacagtgggccttgctgcaaccaccaggacccagaatgtgactgtagga
ggttattaccccggagttattctcggctttggatcgttccttggaatcattggatcaaac
cttattgagaacaaaaggcagatgctggtggcttctatcgtgtttatcagctttggtgtg
attgcggctttttgttgtgccatagttgacggggtctttgctgccagacacattgatctg
aaaccactctacgctaaccggtgccattatgttcccaagacatcacagaaggaagctgag
gaggtcataagttcctcaaccaaaaattctccttccacgagggttatgaggaaccttacc
caggcagctagagaggttaactgccctcacctcagccgtgaattctgcacacctcgcatc
cggggcaacacctgcttctgctgtgacctctacaactgtggcaaccgggtggagatcact
ggtgggtactacgaatacatcgatgtcagcagttgccaagatatcatccacctctaccac
ctgctctggtctgccaccatcctcaacattgttggcctgttcctgggcatcatcactgcc
gctgtccttggaggctttaaggacatgaacccaactctcccagcactgaactgttctgtt
gaaaatacccatccaacagtttcttactatgctcatccccaagtggcatcctacaatacc
tactaccatagccctcctcacctgccaccatattctgcttatgactttcagcattccggt
gtctttccatcctcccctccctctggactttctgatgagccccagtctgcctctccctca
cccagctacatgtggtcctcaagtgcaccgccccgttactctccaccctactatccacct
tttgaaaagccaccaccttacagtccctaa

DBGET integrated database retrieval system