KEGG   Homo sapiens (human): 55032
Entry
55032             CDS       T01001                                 

Gene name
SLC35A5
Definition
(RefSeq) solute carrier family 35 member A5
  KO
K15274  solute carrier family 35 (probable UDP-sugar transporter), member A5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55032 (SLC35A5)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   55032 (SLC35A5)
SSDB
Motif
Pfam: Nuc_sug_transp EamA Cation_efflux
Other DBs
NCBI-GeneID: 55032
NCBI-ProteinID: NP_060415
HGNC: 20792
Ensembl: ENSG00000138459
Vega: OTTHUMG00000159263
Pharos: Q9BS91(Tdark)
UniProt: Q9BS91
Position
3q13.2
AA seq 424 aa
MEKQCCSHPVICSLSTMYTFLLGAIFIALSSSRILLVKYSANEENKYDYLPTTVNVCSEL
VKLVFCVLVSFCVIKKDHQSRNLKYASWKEFSDFMKWSIPAFLYFLDNLIVFYVLSYLQP
AMAVIFSNFSIITTALLFRIVLKRRLNWIQWASLLTLFLSIVALTAGTKTLQHNLAGRGF
HHDAFFSPSNSCLLFRSECPRKDNCTAKEWTFPEAKWNTTARVFSHIRLGMGHVLIIVQC
FISSMANIYNEKILKEGNQLTESIFIQNSKLYFFGILFNGLTLGLQRSNRDQIKNCGFFY
GHSAFSVALIFVTAFQGLSVAFILKFLDNMFHVLMAQVTTVIITTVSVLVFDFRPSLEFF
LEAPSVLLSIFIYNASKPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESD
EDTF
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggaaaaacagtgctgtagtcatcctgtaatatgctccttgtcaacaatgtatacattc
ctgctaggtgccatattcattgctttaagctcaagtcgcatcttactagtgaagtattct
gccaatgaagaaaacaagtatgattatcttccaactactgtgaatgtgtgctcagaactg
gtgaagctagttttctgtgtgcttgtgtcattctgtgttataaagaaagatcatcaaagt
agaaatttgaaatatgcttcctggaaggaattctctgatttcatgaagtggtccattcct
gcctttctttatttcctggataacttgattgtcttctatgtcctgtcctatcttcaacca
gccatggctgttatcttctcaaattttagcattataacaacagctcttctattcaggata
gtgctgaagaggcgtctaaactggatccagtgggcttccctcctgactttatttttgtct
attgtggccttgactgccgggactaaaactttacagcacaacttggcaggacgtggattt
catcacgatgcctttttcagcccttccaattcctgccttcttttcagaagtgagtgtccc
agaaaagacaattgtacagcaaaggaatggacttttcctgaagctaaatggaacaccaca
gccagagttttcagtcacatccgtcttggcatgggccatgttcttattatagtccagtgt
tttatttcttcaatggctaatatctataatgaaaagatactgaaggaagggaaccagctc
actgaaagcatcttcatacagaacagcaaactctatttctttggcattctgtttaatggg
ctgactctgggccttcagaggagtaaccgtgatcagattaagaactgtggatttttttat
ggccacagtgcattttcagtagcccttatttttgtaactgcattccagggcctttcagtg
gctttcattctgaagttcctggataacatgttccatgtcttgatggcccaggttaccact
gtcattatcacaacagtgtctgtcctggtctttgacttcaggccctccctggaatttttc
ttggaagccccatcagtccttctctctatatttatttataatgccagcaagcctcaagtt
ccggaatacgcacctaggcaagaaaggatccgagatctaagtggcaatctttgggagcgt
tccagtggggatggagaagaactagaaagacttaccaaacccaagagtgatgagtcagat
gaagatactttctaa

DBGET integrated database retrieval system