KEGG   Homo sapiens (human): 55033Help
Entry
55033             CDS       T01001                                 

Gene name
FKBP14, EDSKMH, EDSKSCL2, FKBP22, IPBP12
Definition
(RefSeq) FKBP prolyl isomerase 14
  KO
K09577  FK506-binding protein 14 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Disease
H02245  Ehlers-Danlos syndrome kyphoscoliosis type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    55033 (FKBP14)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     55033 (FKBP14)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    55033 (FKBP14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 55033
NCBI-ProteinID: NP_060416
OMIM: 614505
HGNC: 18625
Ensembl: ENSG00000106080
Vega: OTTHUMG00000023442
Pharos: Q9NWM8(Tbio)
UniProt: Q9NWM8 A0A090N7V8
Structure
PDB: 

Position
7p14.3
AA seq 211 aa AA seqDB search
MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDG
SLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIP
PESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHH
DALVEDIFDKEDEDKDGFISAREFTYKHDEL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttttcttgtggaacgcggtcttgactctgttcgtcacttctttgattggggct
ttgatccctgaaccagaagtgaaaattgaagttctccagaagccattcatctgccatcgc
aagaccaaaggaggggatttgatgttggtccactatgaaggctacttagaaaaggacggc
tccttatttcactccactcacaaacataacaatggtcagcccatttggtttaccctgggc
atcctggaggctctcaaaggttgggaccagggcttgaaaggaatgtgtgtaggagagaag
agaaagctcatcattcctcctgctctgggctatggaaaagaaggaaaaggtaaaattccc
ccagaaagtacactgatatttaatattgatctcctggagattcgaaatggaccaagatcc
catgaatcattccaagaaatggatcttaatgatgactggaaactctctaaagatgaggtt
aaagcatatttaaagaaggagtttgaaaaacatggtgcggtggtgaatgaaagtcatcat
gatgctttggtggaggatatttttgataaagaagatgaagacaaagatgggtttatatct
gccagagaatttacatataaacacgatgagttatag

DBGET integrated database retrieval system