KEGG   Homo sapiens (human): 55038
Entry
55038             CDS       T01001                                 

Gene name
CDCA4, HEPP, SEI-3/HEPP
Definition
(RefSeq) cell division cycle associated 4
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SERTA
Other DBs
NCBI-GeneID: 55038
NCBI-ProteinID: NP_060425
OMIM: 612270
HGNC: 14625
Ensembl: ENSG00000170779
Vega: OTTHUMG00000170767
Pharos: Q9BXL8(Tbio)
UniProt: Q9BXL8 A0A024R6P3
Position
14q32.33
AA seq 241 aa
MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSV
LIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAWGQEGAHPAPGLGDG
HTQGPVSDLCPVTSAQAPRHLQSSAWEMDGPRENRGSFHKSLDQIFETLETKNPSCMEEL
FSDVDSPYYDLDTVLTGMMGGARPGPCEGLEGLAPATPGPSSSCKSDLGELDHVVEILVE
T
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtttgcacgaggactgaagaggaaatgtgttggccacgaggaagacgtggagggagcc
ctggccggcttgaagacagtgtcctcatacagcctgcagcggcagtcgctcctggacatg
tctctggtgaagttgcagctttgccacatgcttgtggagcccaacctgtgccgctcagtc
ctcattgccaacacggtccggcagatccaagaggagatgacgcaggatgggacgtggcgc
acagtggcaccccaggctgcagagcgggcgccgctcgaccgcttggtctccacggagatc
ctgtgccgtgcagcgtgggggcaagagggggcacatcctgctcctggcttgggggacggc
cacacacagggtccagtttctgacctttgcccagtcacctcagcacaggcaccaaggcac
ctgcagagcagcgcctgggagatggatggccctcgagaaaacagaggaagctttcacaag
tcacttgatcagatatttgaaacgctggagactaaaaaccccagctgcatggaagagctg
ttctcagacgtggacagcccctactacgacctggacacagtactgacaggcatgatgggg
ggtgccaggccgggcccctgcgaagggctcgagggcttggctccggccaccccaggccct
agctccagctgcaagtccgacctgggcgagctggaccacgtggtggagatcctggtggag
acctga

DBGET integrated database retrieval system