KEGG   Homo sapiens (human): 55039
Entry
55039             CDS       T01001                                 
Symbol
TRMT12, TRM12, TYW2
Name
(RefSeq) tRNA methyltransferase 12 homolog
  KO
K07055  tRNA wybutosine-synthesizing protein 2 [EC:2.5.1.114]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    55039 (TRMT12)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.114  tRNAPhe (4-demethylwyosine37-C7) aminocarboxypropyltransferase
     55039 (TRMT12)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    55039 (TRMT12)
SSDB
Motif
Pfam: Met_10 MTS PrmA Methyltransf_15 Methyltransf_25 Cons_hypoth95
Other DBs
NCBI-GeneID: 55039
NCBI-ProteinID: NP_060426
OMIM: 611244
HGNC: 26091
Ensembl: ENSG00000183665
UniProt: Q53H54
Position
8:124450820..124453026
AA seq 448 aa
MRENVVVSNMERESGKPVAVVAVVTEPWFTQRYREYLQRQKLFDTQHRVEKMPDGSVALP
VLGETLPEQHLQELRNRVAPGSPCMLTQLPDPVPSKRAQGCSPAQKLCLEVSRWVEGRGV
KWSAELEADLPRSWQRHGNLLLLSEDCFQAKQWKNLGPELWETVALALGVQRLAKRGRVS
PDGTRTPAVTLLLGDHGWVEHVDNGIRYKFDVTQCMFSFGNITEKLRVASLSCAGEVLVD
LYAGIGYFTLPFLVHAGAAFVHACEWNPHAVVALRNNLEINGVADRCQIHFGDNRKLKLS
NIADRVILGLIPSSEEGWPIACQVLRQDAGGILHIHQNVESFPGKNLQALGVSKVEKEHW
LYPQQITTNQWKNGATRDSRGKMLSPATKPEWQRWAESAETRIATLLQQVHGKPWKTQIL
HIQPVKSYAPHVDHIVLDLECCPCPSVG
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgagagagaatgtggttgttagcaacatggagagagaaagtgggaagcccgtggctgtt
gtcgcagttgtgactgagccttggtttacccagcgatacagagaatatctccagaggcag
aaactctttgatacacagcaccgtgtggaaaagatgccggatggctcggtggcgctaccg
gtgctgggagagacgcttccagagcagcacctgcaggagctgaggaatcgtgttgcccca
ggcagtccctgtatgctcacgcagctcccggatcctgttccttcgaagagggcccagggt
tgttcacctgcccaaaaattgtgtcttgaggtgagtcgctgggtggagggtcggggagtc
aagtggtcagccgagttggaggctgatttgccccgatcatggcaacggcatggtaatctc
ttgttgctgagtgaagactgtttccaagccaagcagtggaaaaatctgggaccggaactc
tgggagaccgttgccttggcacttggcgtccagcgtttggcaaaacgagggcgggtatca
ccggatggtactcgaactccagcagtgacactgctgctgggtgaccatggctgggtagag
catgtggataatggtatccgttataagtttgacgtgacccagtgtatgttctcctttgga
aacatcactgagaagcttcgagtggcatcgttgtcctgtgctggagaagtgctggtggat
ctctatgcagggattggttattttacattgcctttcctagttcatgctggtgctgccttc
gtccatgcttgtgagtggaatccccatgctgtagttgctctgagaaataaccttgagatc
aatggagtagcagatcggtgccaaatacactttggagataacagaaaactgaagctctca
aatattgcagatagggtgatcctggggctgattcccagctctgaagaaggctggcccatt
gcctgccaagtgttaaggcaggatgctggaggcattttgcatatccaccaaaatgtggaa
tctttcccagggaagaatcttcaggctcttggagtcagcaaagtagagaaagagcattgg
ctgtatcctcagcaaattaccaccaaccaatggaaaaatggagctaccagggattctagg
ggaaaaatgctgtcaccagccaccaagccagagtggcaaaggtgggcagaatctgcagaa
actcgaatcgccactcttcttcagcaggtgcatgggaaaccatggaagacacaaattctg
cacatccaaccagtgaaatcctatgctccccatgtggatcacatagtcctggatctggaa
tgctgcccctgtccttcagttggctag

DBGET integrated database retrieval system