KEGG   Homo sapiens (human): 55048Help
Entry
55048             CDS       T01001                                 

Gene name
VPS37C
Definition
(RefSeq) VPS37C subunit of ESCRT-I
  KO
K12185  ESCRT-I complex subunit VPS37
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    55048 (VPS37C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55048 (VPS37C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    55048 (VPS37C)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    55048 (VPS37C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   55048 (VPS37C)
  Exosomal proteins of colorectal cancer cells
   55048 (VPS37C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mod_r HLH
Motif
Other DBs
NCBI-GeneID: 55048
NCBI-ProteinID: NP_060436
OMIM: 610038
HGNC: 26097
Ensembl: ENSG00000167987
Vega: OTTHUMG00000167826
Pharos: A5D8V6(Tbio)
UniProt: A5D8V6
Position
11q12.2
AA seq 355 aa AA seqDB search
METLKDKTLQELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAERNLEFQGPL
EISRSNLSDRYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAE
KFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGDAPPPRPPPPVR
PVPQGTPPVVEEQPQPPLAMPPYPLPYSPSPSLPVGPTAHGALPPAPFPVVSQPSFYSGP
LGPTYPAAQLGPRGAAGYSWSPQRSMPPRPGYPGTPMGASGPGYPLRGGRAPSPGYPQQS
PYPATGGKPPYPIQPQLPSFPGQPQPSVPLQPPYPPGPAPPYGFPPPPGPAWPGY
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggagacgctgaaggataagaccctgcaggagctggaggagttgcagaatgactcggag
gcgattgaccagctggccctggagtcccctgaggtccaggacctacagctggaacgggag
atggcactggccaccaaccggagcctggcagagcggaacttggagttccagggtcccctg
gagatcagccgctcaaacctctcggatagataccaggagctccggaagctcgtggagcgg
tgccaggagcagaaggcaaagctggagaaattttcttcagcactgcagccagggaccttg
ttagaccttctgcaggtggaaggcatgaagatcgaagaagagtccgaggccatggctgag
aagttcctggagggcgaggtgcccctggaaacgttcctggagaatttttcctccatgagg
atgctgtcccacctgcgccgggttcgcgtggaaaagctccaggaagtggtgaggaagccc
agggcttcccaggagctggccggcgatgcccctccaccccgtccaccacccccggtgcgc
ccagtcccccagggaacaccccctgtggttgaagagcagccgcagccaccattagccatg
cctccctaccctttgccctacagcccatcccccagcctgcctgtgggccccactgcccat
ggagccctgccaccggcccctttcccagtagtgtcccagccctccttctacagcgggcct
ctgggccccacttacccggcagcccagcttggacccaggggtgctgcgggttactcctgg
tccccacagaggagcatgccaccccggccgggctatcctgggaccccaatgggtgcctct
gggcctgggtaccccttgcggggaggcagggcccccagtcctggttatcctcaacagtcc
ccataccccgcaacaggaggaaaacctccctacccaatacagcctcagctccccagcttt
ccaggccagccccagccctcagtgcccctgcagcccccttatccccccgggcccgcccct
ccctatgggttcccaccaccgccggggcctgcctggcctgggtattag

DBGET integrated database retrieval system