KEGG   Homo sapiens (human): 55054Help
Entry
55054             CDS       T01001                                 

Gene name
ATG16L1, APG16L, ATG16A, ATG16L, IBD10, WDR30
Definition
(RefSeq) autophagy related 16 like 1
  KO
K17890  autophagy-related protein 16-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04621  NOD-like receptor signaling pathway
hsa05131  Shigellosis
Disease
H00286  Crohn disease
H01227  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    55054 (ATG16L1)
   04136 Autophagy - other
    55054 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    55054 (ATG16L1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    55054 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55054 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    55054 (ATG16L1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    55054 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    55054 (ATG16L1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    55054 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Nup160 SH3_2 SGL TolB_like DUF2332
Motif
Other DBs
NCBI-GeneID: 55054
NCBI-ProteinID: NP_110430
OMIM: 610767
HGNC: 21498
Ensembl: ENSG00000085978
Pharos: Q676U5(Tbio)
UniProt: Q676U5 Q17RG0
Structure
PDB: 

Position
2q37.1
AA seq 607 aa AA seqDB search
MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEK
HDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRK
DREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKL
RKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDI
EVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT
HPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKG
SLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDN
ARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSES
IVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRV
VFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCK
AVLWAQY
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggcctccgcgccgctgacttcccccgctggaagcgccacatctcggagcaa
ctgaggcgccgggaccggctgcagagacaggcgttcgaggagatcatcctgcagtataac
aaattgctggaaaagtcagatcttcattcagtgttggcccagaaactacaggctgaaaag
catgacgtaccaaacaggcacgagataagtcccggacatgatggcacatggaatgacaat
cagctacaagaaatggcccaactgaggattaagcaccaagaggaactgactgaattacac
aagaaacgtggggagttagctcaactggtgattgacctgaataaccaaatgcagcggaag
gacagggagatgcagatgaatgaagcaaaaattgcagaatgtttgcagactatctctgac
ctggagacggagtgcctagacctgcgcactaagctttgtgaccttgaaagagccaaccag
accctgaaggatgaatatgatgccctgcagatcacttttactgccttggagggaaaactg
aggaaaactacggaagagaaccaggagctggtcaccagatggatggctgagaaagcccag
gaagccaatcggcttaatgcagagaatgaaaaagactccaggaggcggcaagcccggctg
cagaaagagcttgcagaagcagcaaaggaacctctaccagtcgaacaggatgatgacatt
gaggtcattgtggatgaaacttctgatcacacagaagagacctctcctgtgcgagccatc
agcagagcagccactaagcgactctcgcagcctgctggaggccttctggattctatcact
aatatctttgggagacgctctgtctcttccttcccagtcccccaggacaatgtggatact
catcctggttctggtaaagaagtgagggtaccagctactgccttgtgtgtcttcgatgca
catgatggggaagtcaacgctgtgcagttcagtccaggttcccggttactggccactgga
ggcatggaccgcagggttaagctttgggaagtatttggagaaaaatgtgagttcaagggt
tccctatctggcagtaatgcaggaattacaagcattgaatttgatagtgctggatcttac
ctcttagcagcttcaaatgattttgcaagccgaatctggactgtggatgattatcgatta
cggcacacactcacgggacacagtgggaaagtgctgtctgctaagttcctgctggacaat
gcgcggattgtctcaggaagtcacgaccggactctcaaactctgggatctacgcagcaaa
gtctgcataaagacagtgtttgcaggatccagttgcaatgatattgtctgcacagagcaa
tgtgtaatgagtggacattttgacaagaaaattcgtttctgggacattcgatcagagagc
atagttcgagagatggagctgttgggaaagattactgccctggacttaaacccagaaagg
actgagctcctgagctgctcccgtgatgacttgctaaaagttattgatctccgaacaaat
gctatcaagcagacattcagtgcacctgggttcaagtgcggctctgactggaccagagtt
gtcttcagccctgatggcagttacgtggcggcaggctctgctgagggctctctgtatatc
tggagtgtgctcacagggaaagtggaaaaggttctttcaaagcagcacagctcatccatc
aatgcggtggcgtggtcgccctctggctcgcacgttgtcagtgtggacaaaggatgcaaa
gctgtgctgtgggcacagtactga

DBGET integrated database retrieval system