KEGG   Homo sapiens (human): 5506Help
Entry
5506              CDS       T01001                                 

Gene name
PPP1R3A, GM, PP1G, PPP1R3
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 3A
  KO
K07189  protein phosphatase 1 regulatory subunit 3A/B/C/D/E
Organism
hsa  Homo sapiens (human)
Pathway
hsa04910  Insulin signaling pathway
hsa04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5506 (PPP1R3A)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    5506 (PPP1R3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5506 (PPP1R3A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5506 (PPP1R3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBM_21 CBM53
Motif
Other DBs
NCBI-GeneID: 5506
NCBI-ProteinID: NP_002702
OMIM: 600917
HGNC: 9291
Ensembl: ENSG00000154415
Vega: OTTHUMG00000156944
Pharos: Q16821(Tbio)
UniProt: Q16821
Position
7q31.1
AA seq 1122 aa AA seqDB search
MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSEDIYLDTPSSG
TRRVSFADSFGFNLVSVKEFDCWELPSASTTFDLGTDIFHTEEYVLAPLFDLPSSKEDLM
QQLQIQKAILESTESLLGSTSIKGIIRVLNVSFEKLVYVRMSLDDWQTHYDILAEYVPNS
CDGETDQFSFKIVLVPPYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTFICQKKEQEPEP
VKPWKEVPNRQIKGCLKVKSSKEESSVTSEENNFENPKNTDTYIPTIICSHEDKEDLEAS
NRNVKDVNREHDEHNEKELELMINQHLIRTRSTASRDERNTFSTDPVNFPNKAEGLEKKQ
IHGEICTDLFQRSLSPSSSAESSVKGDFYCNEKYSSGDDCTHQPSEETTSNMGEIKPSLG
DTSSDELVQLHTGSKEVLDDNANPAHGNGTVQIPCPSSDQLMAGNLNKKHEGGAKNIEVK
DLGCLRRDFHSDTSACLKESTEEGSSKEDYYGNGKDDEEQRIYLGVNEKQRKNFQTILHD
QERKMGNPKISVAGIGASNRDLATLLSEHTAIPTRAITADVSHSPRTNLSWEEAVLTPEH
HHLTSEGSALGGITGQVCSSRTGNVLRNDYLFQVEEKSGGINSEDQDNSPQHKQSWNVLE
SQGKSRENKTNITEHIKGQTDCEDVWGKRDNTRSLKATTEELFTCQETVCCELSSLADHG
ITEKAEAGTAYIIKTTSESTPESMSAREKAIIAKLPQETARSDRPIEVKETAFDPHEGRN
DDSHYTLCQRDTVGVIYDNDFEKESRLGICNVRVDEMEKEETMSMYNPRKTHDREKCGTG
NITSVEESSWVITEYQKATSKLDLQLGMLPTDKTVFSENRDLRQVQELSKKTDSDAIVHS
AFNSDTNRAPQNSSPFSKHHTEISVSTNEQAIAVENAVTTMASQPISTKSENICNSTREI
QGIEKHPYPESKPEEVSRSSGIVTSGSRKERCIGQIFQTEEYSVEKSLGPMILINKPLEN
MEEARHENEGLVSSGQSLYTSGEKESDSSASTSLPVEESQAQGNESLFSKYTNSKIPYFL
LFLIFLITVYHYDLMIGLTFYVLSLSWLSWEEGRQKESVKKK
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atggagccttctgaagtacctagtcagattagcaaagataattttttagaagttcctaat
ttatctgactctctttgtgaagatgaagaagttactttccaacctggtttctcccctcaa
ccaagtagacgaggttctgattcttctgaagacatatacctggataccccatcttcaggt
actagaagagtttcatttgctgattcctttggattcaatcttgtgtctgttaaagaattt
gattgctgggaattaccgagtgcttcaaccacttttgacttagggacggacattttccac
acagaagaatatgttttagccccactgtttgacttgccttcttcaaaagaagatcttatg
caacaactccaaatacagaaagcaatactggagtcaactgagtctcttcttgggtctaca
agtatcaagggtattattcgagttttgaatgtttcttttgagaagttagtatatgtaaga
atgtctttagatgactggcagacacattatgacattttagcagaatatgttcctaattca
tgtgatggtgaaactgaccagttctcctttaagattgtattggttcctccttatcaaaaa
gatggcagtaaagttgagttttgtatacgttatgaaacttctgttggtacattttggtca
aataataatggcacaaattatacattcatttgtcaaaagaaagaacaagagccggagcct
gtaaaaccatggaaagaagttcctaacagacaaataaaaggctgcttaaaggtaaaatca
agtaaagaagaatcatcagtaacatcagaagaaaataactttgagaatccaaagaataca
gatacctatatcccaacaatcatttgttctcatgaggacaaggaagatttggaagccagt
aatcgaaatgtaaaagatgtaaacagggaacatgatgaacataatgaaaaagaattagag
ttgatgataaatcaacacttaataagaaccagaagtactgcttccagagatgaaaggaat
acattttcaacagatccagtcaattttccaaataaagcagaggggttagagaagaagcaa
atccatggtgaaatatgtactgacttgttccaaaggtctctgtctccaagttcatcagca
gaaagctccgtaaagggagatttttactgcaatgaaaaatattcctcaggagatgactgt
acacatcaaccttcagaggaaactacttcaaatatgggagaaatcaagccatcattggga
gatactagtagtgatgaactagtgcaattacatactggcagcaaagaagtcctggatgat
aatgctaatccagcccatggcaatggcacagtgcaaataccttgcccctcttcagatcaa
ctaatggcaggaaaccttaataaaaaacatgaaggaggagctaaaaatattgaagtaaaa
gatttgggatgtttacgaagagatttccattcagatacgtcggcatgtctcaaagaatca
acagaagaaggatcttctaaggaagattattatggcaatggtaaggatgatgaagaacaa
agaatatatttaggtgttaatgaaaaacaaagaaaaaatttccaaacaatcttacatgac
caagaaaggaagatgggtaaccctaaaataagtgtggcagggattggagctagtaacaga
gacctggctactctgctgagcgaacataccgcaatccccacccgggcaatcacagcagat
gtgtctcattcaccaaggacaaatttaagttgggaagaagctgtgttaaccccagagcat
catcatttgactagtgaaggcagcgctttaggagggataactggtcaagtttgttcatca
agaactggaaatgttttgaggaatgattatcttttccaagttgaagaaaaatcaggtggg
attaattctgaagatcaggataatagcccacagcataaacaaagttggaatgttctggaa
agtcagggaaaatcaagagagaataagacaaacataacagagcatatcaaaggacaaaca
gattgtgaagacgtgtggggaaaaagagataatacgaggagtttgaaagctactacagaa
gaattgtttacctgccaagaaacagtgtgctgtgaactgtcttctctagctgatcatggc
attactgagaaagcagaagctggtacagcctatataattaagacaacatcagaaagtact
ccagaaagcatgtctgctagagaaaaagcaataattgctaagctacctcaagagacagca
cgaagtgacaggcccatcgaggtaaaggaaacagcgtttgatccacatgaagggagaaat
gatgattcacattataccctttgtcaacgagatacagtaggtgtaatctatgacaatgat
tttgaaaaggaatcacgtttaggtatttgtaatgtacgtgtagatgaaatggagaaggaa
gaaaccatgtctatgtacaatcctaggaagacacatgacagggagaaatgtggcactgga
aatataacatctgtggaagaatcctcatgggtcattacagaatatcaaaaagcaacttca
aaactggatttacagttgggaatgttaccaacagacaaaactgtattttcagaaaacaga
gatcttaggcaggttcaagaattatcaaagaaaacagactcggatgccattgtgcattct
gcttttaactcagacactaatagagctcctcagaatagctctcctttttccaaacatcat
actgaaatttcagtgtcaactaatgagcaggcaattgctgtagagaatgcagttactacc
atggctagccaacctatttctacgaaatcagaaaatatttgtaattcaacaagagaaatc
cagggtattgagaagcacccttatcctgagtctaaacctgaagaagtttccagaagttca
ggaatagtgacatcaggtagtagaaaagaaagatgcataggccagattttccaaacagaa
gagtatagtgtggaaaaatctctagggccaatgattttaatcaacaaacctcttgagaat
atggaagaagcaaggcatgaaaatgaaggattagtaagctctgggcaatcactatacact
tcaggtgaaaaggaatctgacagctctgcttctactagtcttcctgttgaggaaagtcaa
gctcaaggcaacgaatctttgttttcaaaatataccaactctaaaataccttatttcctt
ttgtttctgatatttcttataactgtctaccattatgacttaatgattggcttgacattc
tacgttttgtcattgtcctggctatcctgggaagagggtagacaaaaagagtctgtcaaa
aagaagtaa

DBGET integrated database retrieval system