KEGG   Homo sapiens (human): 55062
Entry
55062             CDS       T01001                                 

Gene name
WIPI1, ATG18, ATG18A, WIPI49
Definition
(RefSeq) WD repeat domain, phosphoinositide interacting 1
  KO
K17908  autophagy-related protein 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
Network
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
  Element
N00155  Autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    55062 (WIPI1)
   04136 Autophagy - other
    55062 (WIPI1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    55062 (WIPI1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    55062 (WIPI1)
   05014 Amyotrophic lateral sclerosis
    55062 (WIPI1)
   05016 Huntington disease
    55062 (WIPI1)
   05017 Spinocerebellar ataxia
    55062 (WIPI1)
   05022 Pathways of neurodegeneration - multiple diseases
    55062 (WIPI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55062 (WIPI1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    55062 (WIPI1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    55062 (WIPI1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    55062 (WIPI1)
SSDB
Motif
Pfam: DUF5711 ANAPC4_WD40 BCAS3
Other DBs
NCBI-GeneID: 55062
NCBI-ProteinID: NP_060453
OMIM: 609224
HGNC: 25471
Ensembl: ENSG00000070540
Vega: OTTHUMG00000179873
Pharos: Q5MNZ9(Tbio)
UniProt: Q5MNZ9
Position
17q24.2
AA seq 446 aa
MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDV
YIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEES
IYIHNIKDMKLLKTLLDIPANPTGLCALSINHSNSYLAYPGSLTSGEIVLYDGNSLKTVC
TIAAHEGTLAAITFNASGSKLASASEKGTVIRVFSVPDGQKLYEFRRGMKRYVTISSLVF
SMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMGKMFMAATNYLPTQVSDMMHQ
DRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLL
GSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGP
VCLDDENEFPPIILCRGNQKGKTKQS
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggaggccgaggccgcggacgctcccccgggcggggttgagtcggcgctcagctgcttc
tctttcaaccaggactgcacatccctagcaactggaactaaagccgggtataagctgttt
tctctgagttctgtggagcagctggatcaagtccacggaagcaatgaaatcccggacgtc
tacatcgtggagcgcctcttctccagcagcctggtggtggtagtcagtcacacaaaacca
cggcagatgaacgtgtatcacttcaagaaaggcacagagatctgtaattacagctactcc
agcaacatcttgtccataaggctgaaccggcaaaggctgctggtttgcctagaagagtcc
atttatattcacaacattaaagacatgaagctgttgaagaccctcctggatattcctgca
aacccaacaggtctatgtgctctctctatcaaccattccaattcttacctggcctatcct
ggaagcctgacttcaggggagattgtgctttatgatggaaactccctgaaaacagtctgc
actattgctgcccatgagggaacactagctgccatcaccttcaatgcctcaggctccaaa
ctagcaagtgcgtctgaaaaaggcacagtcatccgggtgttctctgtccctgatgggcaa
aagctctatgagttccggagagggatgaaaaggtatgtgacaatcagctctctagtgttc
agtatggattcacaattcctctgcgcctccagtaacaccgagacggtacacatcttcaag
ctggaacaggtcaccaacagtcgaccagaagagccttcgacctggagtggctacatggga
aagatgtttatggctgctaccaactacctccctacccaggtgtcagacatgatgcatcag
gacagggcttttgccactgcacgcttgaacttctccggacagaggaacatctgtaccctc
tcaacgatccagaagttgccacggctgctagttgcgtcatccagtggacacctttatatg
tacaatttggatcctcaggatggaggagagtgtgtcttaatcaaaacccacagcttgctt
ggctcaggaacaacagaagagaataaagaaaatgacctcagaccttccttacctcagtct
tatgcagcgaccgtagccagaccaagtgcatcttcagcctccacggtgccaggttattct
gaggacggcggggcgctgcgaggagaagttattcctgaacatgagtttgcgacgggacca
gtgtgtcttgatgatgagaatgagtttcctcctataatcttgtgccgtggaaatcagaag
ggcaaaacgaagcagtcatga

DBGET integrated database retrieval system