KEGG   Homo sapiens (human): 55062
Entry
55062             CDS       T01001                                 

Gene name
WIPI1, ATG18, ATG18A, WIPI49
Definition
(RefSeq) WD repeat domain, phosphoinositide interacting 1
  KO
K17908  autophagy-related protein 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05131  Shigellosis
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
  Element
N00155  Autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    55062 (WIPI1)
   04136 Autophagy - other
    55062 (WIPI1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    55062 (WIPI1)
   05014 Amyotrophic lateral sclerosis
    55062 (WIPI1)
   05016 Huntington disease
    55062 (WIPI1)
   05017 Spinocerebellar ataxia
    55062 (WIPI1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    55062 (WIPI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55062 (WIPI1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    55062 (WIPI1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55062 (WIPI1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    55062 (WIPI1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    55062 (WIPI1)
Transporters [BR:hsa02000]
 Other transporters
  Others
   55062 (WIPI1)
SSDB
Motif
Pfam: DUF5711 ANAPC4_WD40 BCAS3
Other DBs
NCBI-GeneID: 55062
NCBI-ProteinID: NP_060453
OMIM: 609224
HGNC: 25471
Ensembl: ENSG00000070540
Vega: OTTHUMG00000179873
Pharos: Q5MNZ9(Tbio)
UniProt: Q5MNZ9
Position
17q24.2
AA seq 446 aa
MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDV
YIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEES
IYIHNIKDMKLLKTLLDIPANPTGLCALSINHSNSYLAYPGSLTSGEIVLYDGNSLKTVC
TIAAHEGTLAAITFNASGSKLASASEKGTVIRVFSVPDGQKLYEFRRGMKRYVTISSLVF
SMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMGKMFMAATNYLPTQVSDMMHQ
DRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLL
GSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGP
VCLDDENEFPPIILCRGNQKGKTKQS
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggaggccgaggccgcggacgctcccccgggcggggttgagtcggcgctcagctgcttc
tctttcaaccaggactgcacatccctagcaactggaactaaagccgggtataagctgttt
tctctgagttctgtggagcagctggatcaagtccacggaagcaatgaaatcccggacgtc
tacatcgtggagcgcctcttctccagcagcctggtggtggtagtcagtcacacaaaacca
cggcagatgaacgtgtatcacttcaagaaaggcacagagatctgtaattacagctactcc
agcaacatcttgtccataaggctgaaccggcaaaggctgctggtttgcctagaagagtcc
atttatattcacaacattaaagacatgaagctgttgaagaccctcctggatattcctgca
aacccaacaggtctatgtgctctctctatcaaccattccaattcttacctggcctatcct
ggaagcctgacttcaggggagattgtgctttatgatggaaactccctgaaaacagtctgc
actattgctgcccatgagggaacactagctgccatcaccttcaatgcctcaggctccaaa
ctagcaagtgcgtctgaaaaaggcacagtcatccgggtgttctctgtccctgatgggcaa
aagctctatgagttccggagagggatgaaaaggtatgtgacaatcagctctctagtgttc
agtatggattcacaattcctctgcgcctccagtaacaccgagacggtacacatcttcaag
ctggaacaggtcaccaacagtcgaccagaagagccttcgacctggagtggctacatggga
aagatgtttatggctgctaccaactacctccctacccaggtgtcagacatgatgcatcag
gacagggcttttgccactgcacgcttgaacttctccggacagaggaacatctgtaccctc
tcaacgatccagaagttgccacggctgctagttgcgtcatccagtggacacctttatatg
tacaatttggatcctcaggatggaggagagtgtgtcttaatcaaaacccacagcttgctt
ggctcaggaacaacagaagagaataaagaaaatgacctcagaccttccttacctcagtct
tatgcagcgaccgtagccagaccaagtgcatcttcagcctccacggtgccaggttattct
gaggacggcggggcgctgcgaggagaagttattcctgaacatgagtttgcgacgggacca
gtgtgtcttgatgatgagaatgagtttcctcctataatcttgtgccgtggaaatcagaag
ggcaaaacgaagcagtcatga

KEGG   Homo sapiens (human): 26100
Entry
26100             CDS       T01001                                 

Gene name
WIPI2, ATG18B, Atg21, CGI-50, IDDSSA, WIPI-2
Definition
(RefSeq) WD repeat domain, phosphoinositide interacting 2
  KO
K17908  autophagy-related protein 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05131  Shigellosis
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
  Element
N00155  Autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    26100 (WIPI2)
   04136 Autophagy - other
    26100 (WIPI2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26100 (WIPI2)
   05014 Amyotrophic lateral sclerosis
    26100 (WIPI2)
   05016 Huntington disease
    26100 (WIPI2)
   05017 Spinocerebellar ataxia
    26100 (WIPI2)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    26100 (WIPI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26100 (WIPI2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    26100 (WIPI2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    26100 (WIPI2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    26100 (WIPI2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    26100 (WIPI2)
Transporters [BR:hsa02000]
 Other transporters
  Others
   26100 (WIPI2)
SSDB
Motif
Pfam: ANAPC4_WD40 VID27
Other DBs
NCBI-GeneID: 26100
NCBI-ProteinID: NP_056425
OMIM: 609225
HGNC: 32225
Ensembl: ENSG00000157954
Vega: OTTHUMG00000121179
Pharos: Q9Y4P8(Tbio)
UniProt: Q9Y4P8 A0A024R823
Position
7p22.1
AA seq 454 aa
MNLASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSLAVGSKSGYKFFSLSS
VDKLEQIYECTDTEDVCIVERLFSSSLVAIVSLKAPRKLKVCHFKKGTEICNYSYSNTIL
AVKLNRQRLIVCLEESLYIHNIRDMKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSAT
IGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASEKGTVIRVFSIPEGQKLFE
FRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETVKEKPPEEPTTWTGYFGKVLM
ASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQKIPRLLVGAADGYLYMYNLD
PQEGGECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYT
DDLGAVGGACLEDEASALRLDEDSEHPPMILRTD
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgaacctggcgagccagagcggggaggccggcgccggccagctgctcttcgccaacttc
aaccaggacaacacagaagtgaaaggggcatcaagagcagctggtcttggccgtcgcgct
gttgtctggtccctagctgttggtagtaagtccggttataaatttttctccctttcttct
gtggataagctggaacagatctatgaatgcaccgatacggaagatgtgtgcattgtagag
agattgttctccagcagcctagtggccatcgtcagccttaaagcaccaaggaagctaaag
gtttgccactttaagaagggaactgagatctgcaactacagctactccaacacgattctg
gctgtgaagctcaacaggcagaggctgatagtatgcctggaggagtccctgtacatccac
aacattcgggacatgaaggtgctgcatacgatcagggagacgcctccaaaccctgcaggc
ctgtgtgcgctgtcaatcaacaacgacaactgctacttggcgtacccagggagcgcgacc
atcggagaggtgcaggtcttcgataccattaatttgagagctgcaaacatgattccggct
cacgacagtcctttagcggcactggcctttgacgcaagtggaactaaacttgccacggct
tcggagaaggggaccgtgattagggtattttccattccagaaggacaaaaactctttgag
tttcggagaggagtaaagaggtgcgtgagcatctgctccctggccttcagcatggacggc
atgttcctctccgcctccagcaacactgagaccgtgcacatcttcaaactcgagactgtg
aaagaaaaacccccagaggagcccaccacctggaccgggtacttcgggaaagtgctcatg
gcctccaccagctacctgccttcccaagtgacagaaatgttcaaccagggcagagccttc
gccacggtccgcctgccattctgcggccacaaaaacatctgctcgctagccacaattcag
aagatcccgcggttgttggtgggtgccgccgacgggtacctgtacatgtacaacctggac
ccccaggagggcggcgagtgtgccctgatgaagcagcaccggctggacggcagtctggaa
acgaccaatgagatcttggactctgcctctcacgactgccccttagtcactcagacatac
ggcgcagctgcaggaaaaggtacttacgtgccttcatccccaacgagacttgcctacaca
gacgacctgggtgctgtgggtggcgcctgcctggaggacgaggccagcgccctgcgcctg
gatgaggacagcgagcacccgcccatgattcttcggactgactga

KEGG   Homo sapiens (human): 53349
Entry
53349             CDS       T01001                                 

Gene name
ZFYVE1, DFCP1, PPP1R172, SR3, TAFF1, ZNFN2A1
Definition
(RefSeq) zinc finger FYVE-type containing 1
  KO
K17603  zinc finger FYVE domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
  Element
N00155  Autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    53349 (ZFYVE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    53349 (ZFYVE1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    53349 (ZFYVE1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    53349 (ZFYVE1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     53349 (ZFYVE1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    53349 (ZFYVE1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    53349 (ZFYVE1)
SSDB
Motif
Pfam: FYVE zf-B_box GBP AIG1 Eapp_C DUF429
Other DBs
NCBI-GeneID: 53349
NCBI-ProteinID: NP_067083
OMIM: 605471
HGNC: 13180
Ensembl: ENSG00000165861
Vega: OTTHUMG00000171365
Pharos: Q9HBF4(Tbio)
UniProt: Q9HBF4
Position
14q24.2
AA seq 777 aa
MSAQTSPAEKGLNPGLMCQESYACSGTDEAIFECDECCSLQCLRCEEELHRQERLRNHER
IRLKPGHVPYCDLCKGLSGHLPGVRQRAIVRCQTCKINLCLECQKRTHSGGNKRRHPVTV
YNVSNLQESLEAEEMDEETKRKKMTEKVVSFLLVDENEEIQVTNEEDFIRKLDCKPDQHL
KVVSIFGNTGDGKSHTLNHTFFYGREVFKTSPTQESCTVGVWAAYDPVHKVAVIDTEGLL
GATVNLSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFLGDASEAYLKHFTKELKATTA
RCGLDVPLSTLGPAVIIFHETVHTQLLGSDHPSEVPEKLIQDRFRKLGRFPEAFSSIHYK
GTRTYNPPTDFSGLRRALEQLLENNTTRSPRHPGVIFKALKALSDRFSGEIPDDQMAHSS
FFPDEYFTCSSLCLSCGVGCKKSMNHGKEGVPHEAKSRCRYSHQYDNRVYTCKACYERGE
EVSVVPKTSASTDSPWMGLAKYAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEIV
HVWPGTDGFLKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQ
ILSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDNCYEARNV
QLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIPLGLVKDAARPAYWVPDHEILH
CHNCRKEFSIKLSKHHCRACGQGFCDECSHDRRAVPSRGWDHPVRVCFNCNKKPGDL
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgagtgcccagacttccccagcagagaagggcctgaatccggggctgatgtgccaggaa
agttacgcttgcagcgggactgatgaagctatctttgagtgtgatgagtgctgcagtctg
cagtgtctccgctgcgaggaggagctccatcggcaggagcgcctgagaaaccatgagcgg
ataagactcaaacctggccatgtcccttactgtgacctctgcaagggtctcagtgggcat
ttaccaggtgttaggcagagggcaatagtgaggtgccagacctgcaaaattaacttgtgc
ctggagtgccagaagaggactcattctgggggtaacaaaaggagacaccctgttactgtg
tacaatgtcagtaatctccaggagtcactggaggcagaagagatggatgaggagaccaag
aggaagaagatgactgagaaggttgtgagtttcctcctagtagacgaaaatgaagaaatt
caggtaacaaatgaagaagactttattagaaaattggactgcaaacctgatcagcatctg
aaagtggtttccatttttggaaatactggtgatggaaagtctcatactctcaaccacact
ttcttttatggtcgtgaagtctttaaaacctccccgacccaggagtcctgcactgtggga
gtgtgggcagcctatgacccagttcacaaagtagcagtgatcgatacggaagggctcctg
ggggccaccgtgaatctaagccagagaacacggctgctgcttaaggtcctggccatctca
gacctcgtcatctatcgaactcatgcagaccggctgcataacgacctcttcaaattcctt
ggggatgcctcagaagcttatctgaagcacttcaccaaggagctcaaggccaccactgct
cgctgtggcctggatgtccctttatccacactgggccctgcagttatcatcttccatgag
accgtgcacacccagctactgggctctgatcatccctcagaggtgccagagaagctcatc
caggaccggttccggaagctgggccgtttccctgaagcctttagttccattcactacaag
ggaacgaggacttacaaccctcccacggacttttctgggcttcggcgtgctttggagcag
ctactagagaataacaccacccgttctccccggcacccgggagtcatcttcaaagccctg
aaggcactaagtgaccgcttcagcggtgagatccccgatgaccagatggcgcacagctcc
ttttttccagatgagtatttcacctgctcctccttgtgcctcagctgtggggttggatgt
aagaaaagcatgaatcatgggaaggaaggagtgcctcatgaagccaagagccgctgcaga
tactcccaccagtatgacaaccgagtgtatacctgcaaggcctgctatgagagaggcgag
gaagtcagtgtagtgcccaaaacatctgcttccactgactccccctggatgggtctcgca
aaatatgcctggtctgggtatgtgatcgaatgtcctaactgtggcgtggtctatcgtagt
cggcagtactggtttggaaaccaagatcctgtggatacggtggtgcggacagagattgtg
catgtgtggcctggaactgatgggtttctgaaggacaacaacaatgctgcccagcgcctg
ttggacgggatgaacttcatggctcagtcggtgtccgagcttagccttggacccaccaag
gctgtgacttcctggctgacagaccagatcgcccctgcctactggaggcccaactcccag
attctgagctgcaacaagtgtgcgacgtcctttaaagataacgacactaagcatcactgc
cgagcctgtggggagggcttctgtgacagctgttcatcaaagactcggccagtgcctgag
cggggctggggccctgcgccagtgcgggtctgtgacaactgctacgaagccaggaacgtc
cagttagctgttaccgaggcacaagtggacgatgaaggtggaacgctcattgctcggaag
gtgggcgaggccgtgcagaacactctgggagccgtggtgacagccattgacataccacta
ggtctggtaaaggacgcggccaggcctgcgtactgggtgcctgaccacgaaatcctccac
tgccacaactgccggaaggagttcagcatcaagctctccaagcaccactgccgggcctgc
ggacagggcttctgtgatgagtgctcccatgaccgccgggctgttccttctcgtggctgg
gaccatcccgtccgagtctgcttcaactgcaataaaaagcccggtgacctttaa

DBGET integrated database retrieval system