KEGG   Homo sapiens (human): 550631
Entry
550631            CDS       T01001                                 

Gene name
CCDC157
Definition
(RefSeq) coiled-coil domain containing 157
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Noelin-1 Crescentin Fez1 GAS FPP
Other DBs
NCBI-GeneID: 550631
NCBI-ProteinID: NP_001017437
HGNC: 33854
Ensembl: ENSG00000187860
Vega: OTTHUMG00000151007
Pharos: Q569K6(Tdark)
UniProt: Q569K6
Position
22q12.2
AA seq 752 aa
MAHLLGSQACMESLRTDLTDLQGAIVDVFSRAGPVRFPSWKFPDRMACDLDMVALLEHYD
HVPGDPEFTQLSHAVLLELVIDRLLLLLQSCMSYLENLGSEQMMPPAQAAGPCMSVGLTV
RRFWDSLLRLGTLHQQPLPQKGANQRETPTSKPTTKGEPARSPEYLTTKLIKPSSPVLGL
PQTCQEPESIPVRASLQFPATTFKNTRSVHSQTIETALVPCDACASVQGSLQKVGKVVIS
LCQSQNLPSSLGQFQQLVQDSMGLRPLPAATVGRWAAEQRKDLTRLSKHVEALRAQLEEA
EGQKDGLRKQAGKLEQALKQEQGARRRQAEEDEQCLSEWEHDKQQLLTETSDLKTKMATL
ERELKQQRESTQAVEAKAQQLQEEGERRAAAERQVQQLEEQVQQLEAQVQLLVGRLEGAG
QQVCWASTELDKEKARVDSMVRHQESLQAKQRALLKQLDSLDQEREELRGSLDEAEAQRA
RVEEQLQSEREQGQCQLRAQQELLQSLQREKQGLEQATTDLRLTILELERELEELKERER
LLVAFPDLHRPTETQIHGGRSSSVESQITCPTDSGNVTDHMERQVQANDIRIRVLQEENG
RLQSMLSKIREVAQQGGLKLIPQDRLWSPSSKGTQGATPPVQAKSTSPGPLGRQHLPSSR
TGRTLLGQPCTSPPRQPCTSPPRQPCTSPPRQPCTSPSRQPCSQPSKSLLEGVTHLDTCT
QNPIKVLVRLRKRLSPGRGQASSAHQPQERPM
NT seq 2259 nt   +upstreamnt  +downstreamnt
atggcgcacctgctgggcagccaggcctgcatggagagcctgcgcacagacctcaccgac
ctgcagggtgccatcgtagacgtcttctcccgcgccgggcctgtgcgcttcccctcctgg
aagttccctgaccgcatggcctgtgacctcgacatggtggccctgctggagcactatgac
catgttccgggtgaccccgagttcacgcagctgtcccatgccgtgctgctggagctggtc
atcgacaggctcctgctgctgcttcaaagctgtatgagctacttggagaaccttggctca
gagcagatgatgccccctgcacaggctgcggggccctgcatgtccgtggggctcacggtg
cggcgcttctgggacagcctgctgaggctgggcacgctccaccagcagccactcccccag
aaaggggcaaaccaaagggagactcccacctccaagcccaccaccaagggcgagccagcc
aggagccctgaatatctgactaccaagttaatcaagccctcctccccagtgctaggcttg
ccccagacctgccaagagccagagagcatccctgtcagagcctccctgcagttcccagcc
acgaccttcaagaacaccaggagtgtccactcccagaccattgagacggccctggtgccc
tgtgacgcatgcgccagcgtccagggaagcctgcagaaggtgggcaaggtggtcatcagc
ctgtgtcagagccagaacctgccctcgtccttaggccagttccagcaactggtgcaggac
agcatggggctcaggccactgccggctgccaccgtgggccgctgggcagcagagcagagg
aaagacctgacgcgcctcagtaagcatgtggaggccctcagggcccagctggaggaggct
gaagggcagaaggatggcctgaggaagcaggcgggcaagctggagcaggcgctgaaacag
gagcagggggcacggcggcgacaggcggaggaggatgagcagtgcctgtctgagtgggag
cacgacaaacagcagctgctcacagaaacaagtgacctaaagacaaagatggccaccctg
gagagagaactgaaacagcagcgggagtccacacaggctgtggaggcaaaggcccagcag
ctgcaggaggaaggtgagcgcagggcggcagcggagaggcaggtgcagcagctggaggag
caggtgcagcagttggaggcgcaggtgcagctgttggtgggtcggctggagggcgctggc
cagcaggtctgctgggccagcacggagctggataaggagaaggcccgtgtcgacagcatg
gtccgccaccaggagtctctgcaggccaagcagcgagccctgctaaagcagctggacagc
ctggaccaggaacgtgaggagctgcggggcagcctggacgaggctgaggcccagcgggcc
cgcgtggaggagcagctgcagagcgagcgggagcaggggcaatgccagctcagggcccag
caggagctgctgcagagcctgcagagggagaagcaaggcctggagcaggcgactacggac
ctgcggctaaccatcctggagctagaacgggagctggaggagctgaaggagcgggagcgg
ctgctggtggccttcccagacctgcacaggcccaccgagacccagatccatggaggcaga
tccagcagcgtggaatcccagataacatgtcccacagactctggcaacgtcacagatcac
atggagaggcaagtgcaggccaacgacatccgcatccgggtcctacaggaggagaacggg
cggctccaatcaatgctgtccaaaatccgggaagtggcccagcagggtggcctcaagctg
atcccgcaggaccggctctggtccccttccagcaagggaacccagggagcaacaccacca
gtccaggccaagagcacatccccagggcctctgggcagacagcaccttcctagcagcagg
acgggtaggaccctgctgggccagccctgcacatccccacctcggcagccctgcacatcc
ccacctcggcagccctgcacatccccacctcggcagccctgcacatccccatctcggcag
ccctgcagccagcccagcaagtccttgctggagggtgtgacccacttggacacctgcacc
cagaaccccatcaaggtcttggtcaggctgagaaagagactgtcacctggccggggacag
gccagctctgcacaccagccccaggagcggcccatgtag

DBGET integrated database retrieval system