KEGG   Homo sapiens (human): 550643
Entry
550643            CDS       T01001                                 
Symbol
NBDY, LINC01420, NoBody
Name
(RefSeq) negative regulator of P-body association
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: NoBody
Other DBs
NCBI-GeneID: 550643
NCBI-ProteinID: NP_001335058
OMIM: 300992
HGNC: 50713
Ensembl: ENSG00000204272
UniProt: A0A0U1RRE5 A0A4P8PLQ7
Position
X:56729243..56819179
AA seq 68 aa
MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLK
SHPPPPEK
NT seq 207 nt   +upstreamnt  +downstreamnt
atgggagaccaaccttgtgcctccgggagatccactctcccacctggaaacgcacgggaa
gccaagcctccaaaaaagcgctgcctcctcgctccgcgttgggattatccggaaggaact
cccaacggaggtagtaccactctaccctccgcacctcctcctgcatcagccggcctgaag
tcgcaccctcctcctccggagaagtag

DBGET integrated database retrieval system