KEGG   Homo sapiens (human): 55066Help
Entry
55066             CDS       T01001                                 

Gene name
PDPR, PDP3
Definition
(RefSeq) pyruvate dehydrogenase phosphatase regulatory subunit
  KO
K17509  pyruvate dehydrogenase phosphatase regulatory subunit
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    55066 (PDPR)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   Pyruvate dehydrogenase phosphatases
    Regulatory subunit
     55066 (PDPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T DAO FAO_M GCV_T_C FAD_binding_2 Pyr_redox_2 Thi4 FAD_binding_3 Pyr_redox_3 Trp_halogenase GMC_oxred_N HI0933_like NAD_binding_8 TrkA_N FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 55066
NCBI-ProteinID: NP_001309046
OMIM: 617835
HGNC: 30264
Ensembl: ENSG00000090857
Vega: OTTHUMG00000176963
Pharos: Q8NCN5(Tdark)
UniProt: Q8NCN5
Position
16q22.1
AA seq 879 aa AA seqDB search
MMFYRLLSIVGRQRASPGWQNWSSARNSTSAAEARSMALPTQAQVVICGGGITGTSVAYH
LSKMGWKDIVLLEQGRLAAGSTRFCAGILSTARHLTIEQKMADYSNKLYYQLEQETGIQT
GYTRTGSIFLAQTQDRLISLKRINAGLNVIGIPSEIISPKKVAELHHLLNVHDLVGAMHV
PEDAVVSSADVALALASAASQNGVQIYDRTSVLHVMVKKGQVTGVETDKGQIECQYFVNC
AGQWAYELGLSNEEPVSIPLHACEHFYLLTRPLETPLQSSTPTIVDADGRIYIRNWQGGI
LSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEIMKLVNCPET
FTPDMRCIMGESPAVQGYFVLAGMNSAGLSFGGGAGKYLAEWMVHGYPSENVWELDLKRF
GALQSSRTFLRHRVMEVMPLMYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFE
RPKYFVPPDKDLLALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEITSTGDQ
ALEVLQYLFSNDLDVPVGHIVHTGMLNEGGGYENDCSIARLNKRSFFMISPTDQQVHCWA
WLKKHMPKDSNLLLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPSLFCKEMSVGY
ANGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFA
FWGQDINNLTTPLECGRESRVKLEKGMDFIGRDALLQQKQNGVYKRLTMFILDDHDSDLD
LWPWWGEPIYRNGQYVGKTTSSAYSYSLERHVCLGFVHNFSEDTGEEQVVTADFINRGEY
EIDIAGYRFQAKAKLYPVASLFTQKRRKDDMELSDLHGK
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgatgttctaccggttgctgtcgattgttggaagacaaagagccagcccaggatggcag
aactggtcctctgcaagaaacagcacgtcagctgccgaggcgcgttccatggccctgccc
acccaggcacaggtggtcatctgtggaggtggaatcacgggcacttctgtggcctatcac
ctctccaaaatggggtggaaggatattgtccttttggagcagggcaggctggctgctggc
tctaccaggttctgtgctggcatcctgagcactgccaggcacttgaccattgagcagaag
atggcagactactcaaacaaactctactatcagttagagcaagaaacagggatccaaaca
ggttacacaaggacaggctcaatctttctggcccaaactcaggaccgactgatctccctg
aagcgcatcaacgcagggctgaatgttataggtatcccttctgagatcatctcccccaag
aaagtggccgagcttcaccatctcctcaacgtgcacgacctggtgggggccatgcatgtt
cccgaggatgcagtggtgtcttccgctgacgtggctcttgccctggcaagtgctgcctcc
caaaatggtgttcagatctatgaccggacatctgttcttcatgtaatggtcaaaaaaggt
caagttactggagtggagaccgataaaggacagattgaatgccagtattttgtcaactgt
gctggccagtgggcatacgagctgggtctgtccaacgaggagccggttagtatcccgcta
catgcctgcgaacacttctacctcctgactcgccccttggagacccctctgcagagcagc
acaccaactattgtggatgctgatggaagaatttatattcggaactggcagggtggcatc
ctgtctgggggctttgagaagaacccgaaaccaattttcactgagggcaagaaccagctg
gagattcagaatctacaggaagactgggatcactttgagcctctgttgagttcccttctg
aggaggatgccagaattagagactctggagatcatgaagttggtgaactgcccagagacc
ttcacaccagacatgaggtgcatcatgggcgagtctcctgcagtgcagggctactttgtc
ctggcaggaatgaactctgctggcctttcatttggtggaggagccggaaagtaccttgcc
gaatggatggtacatggttatccctcagaaaacgtttgggaattggacctgaaacgtttt
ggagccctccagagcagccgcacctttctgcgccaccgggtcatggaagtcatgcctttg
atgtatgatctgaaggttccccgctgggacttccagaccggtaggcagttacgcacctct
cctctctacgaccggctggatgcacagggagccaggtggatggagaaacatggatttgag
aggccaaagtactttgttccccccgacaaggacctcctggcattggagcagagcaagact
ttctataagccagattggtttgacatcgtggagtctgaagtcaagtgctgtaaggaagct
gtgtgtgtcattgacatgtcctctttcacaaagtttgagataacatccactggggatcag
gcattagaagttctacagtacctcttctccaatgacctggatgtgcctgtgggccacatt
gtgcatactggcatgctcaacgagggtggagggtatgaaaatgactgcagcatagcacga
ctgaacaagcgcagtttcttcatgatctctccaaccgaccagcaggtccactgttgggcc
tggcttaagaaacacatgccgaaagacagcaacctgctcctggaggacgtcacctggaag
tacacagccctcaatctgattggccctcgagctgtggatgtgctgtctgagttgtcctat
gcccctatgactccagaccacttcccaagcctcttttgcaaggagatgagtgtgggctat
gcaaatgggatccgggtgatgagcatgacgcacacaggagagccaggattcatgctctac
atccccatagagtacgccctgcatgtatacaatgaagtgatgagtgttggccagaaatac
ggaatccggaatgctgggtattacgctcttcgcagtctccgaattgagaagttttttgcc
ttctggggtcaggatataaataacctcaccacgcccctggaatgtggacgagagtctcgg
gtgaaattagagaagggcatggatttcattggtcgcgacgccctcctgcagcagaagcag
aatggagtgtataaacgcctcaccatgttcatcctggacgaccatgattcagacctagac
ctttggccttggtggggagagcccatttaccggaatgggcagtatgttggcaagaccacc
agcagtgcctacagctacagcctggagcgccacgtttgcctgggctttgtgcacaatttt
tctgaggacacgggggaagagcaagtggtgacagcagatttcatcaaccggggagagtat
gagattgacatcgcgggataccgcttccaggccaaggccaagctctaccctgtcgcctcc
ctcttcacccagaagcgccgaaaggatgacatggagctgagtgacttacatgggaagtga

DBGET integrated database retrieval system