KEGG   Homo sapiens (human): 55070Help
Entry
55070             CDS       T01001                                 

Gene name
DET1
Definition
(RefSeq) DET1, COP1 ubiquitin ligase partner
  KO
K10571  de-etiolated-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    55070 (DET1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     55070 (DET1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Det1
Motif
Other DBs
NCBI-GeneID: 55070
NCBI-ProteinID: NP_001137546
OMIM: 608727
HGNC: 25477
Ensembl: ENSG00000140543
Vega: OTTHUMG00000171851
Pharos: Q7L5Y6(Tdark)
UniProt: Q7L5Y6 A0A024RC56
Position
15q26.1
AA seq 550 aa AA seqDB search
MDHHVSTIKPRRIQNQNVIHRLERRRISSGKAGTHWHQVRVFHQNVFPNFTVVNVEKPPC
FLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRL
FERFFVLLHITNVAANGEHLNRECSLFTDDCRCVIVGSAAYLPDEPHPPFFEVYRNSESV
TPNPRSPLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNILAILSVQQQTIH
VFQVTPEGTFIDVRTIGRFCYEDDLLTVSAVFPEVQRDSQTGMANPFRDPFINSLKHRLL
VYLWRRAEQDGSAMAKRRFFQYFDQLRQLRMWKMQLLDENHLFIKYTSEDVVTLRVTDPS
QASFFVVYNMVTTEVIAVFENTSDELLELFENFCDLFRNATLHSEVQFPCSASSNNFARQ
IQRRFKDTIINAKYGGHTEAVRRLLGQLPISAQSYSGSPYLDLSLFSYDDKWVSVMERPK
TCGDHPIRFYARDSGLLKFEIQAGLLGRPINHTVRRLVAFTFHPFEPFAISVQRTNAEYV
VNFHMRHCCT
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggatcatcatgtttctaccatcaagcctcgaagaatccaaaaccaaaatgtcattcac
cgcttggaacgccggcggatcagttcaggcaaggcaggtacccactggcaccaagtccga
gtgttccatcagaatgtcttccccaacttcacagttgtcaacgttgaaaagcctccttgt
ttcttgcgtaaattctcacctgatggacgctactttattgctttttcttcagaccagaca
tctcttgaaatctatgagtaccagggctgccaggcagcagaggacctactgcagggatac
gaaggagaaatcctgtccaatggcaatgaccagcggtcagtgaatatccggggccggctc
tttgaacgcttttttgtcctgctgcacattaccaatgttgcggccaatggtgagcacctg
aaccgggagtgtagtctcttcactgatgactgccgctgtgtcatcgtgggctcagctgcc
tacctcccagatgagcctcaccctccattttttgaggtatatcggaacagtgaatcagtg
acccccaacccacggtcccctctagaagactattccctccatatcattgaccttcacacc
ggccgcttatgtgatacacgcacgttcaagtgtgacaaggtggtcttgtcacacaaccaa
gggctgtacttgtacaaaaacatcctggccatcttgtctgtgcaacaacagaccatccat
gtcttccaggtgactcctgaaggcactttcattgatgtgcggaccattggccgcttttgc
tatgaggatgacctgctcactgtgtcagctgttttccctgaggtacagcgggacagtcag
acaggcatggccaatccctttagggatcctttcatcaattccctcaaacaccggttgctg
gtatatttgtggcgccgggcagaacaggatggtagtgcaatggccaagaggcgcttcttc
cagtattttgaccaactgcggcagctgcgaatgtggaaaatgcagcttctggatgaaaac
cacctgtttatcaagtacactagtgaggatgtagtaacactgcgagtcacagatccatca
caggcatctttctttgtggtgtacaatatggtgacgacagaggtgattgctgtgtttgag
aatacatcagatgagcttttggagctctttgagaacttctgtgacctttttcgtaatgct
accctgcacagtgaagttcagtttccctgctcagcttctagcaacaattttgcaaggcag
atccagcgccggttcaaagacactattataaatgccaagtatggagggcacacagaggca
gtacgccggctgctgggtcagctccccatcagtgctcagtcttacagcggtagcccctat
ctggatttgtctctcttcagttatgatgacaagtgggtatctgtcatggagcggcccaag
acttgtggagatcacccaatcaggttctatgcccgggactcgggcctgctcaagtttgag
atccaggcggggttattgggccgccccatcaaccacacagtgcgacgccttgttgccttc
acctttcacccttttgagcctttcgctatttctgtgcagaggactaatgctgagtatgtt
gtcaacttccatatgcgacactgctgcacgtag

DBGET integrated database retrieval system