KEGG   Homo sapiens (human): 55075
Entry
55075             CDS       T01001                                 
Symbol
UACA, NUCLING
Name
(RefSeq) uveal autoantigen with coiled-coil domains and ankyrin repeats
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank_3 Ank MAD Lebercilin TolA_bind_tri Tropomyosin
Other DBs
NCBI-GeneID: 55075
NCBI-ProteinID: NP_060473
OMIM: 612516
HGNC: 15947
Ensembl: ENSG00000137831
Pharos: Q9BZF9(Tbio)
UniProt: Q9BZF9
Position
15:complement(70654554..70778903)
AA seq 1416 aa
MKSLKSRLRRQDVPGPASSGAAAASAHAADWNKYDDRLMKAAERGDVEKVTSILAKKGVN
PGKLDVEGRSVFHVVTSKGNLECLNAILIHGVDITTSDTAGRNALHLAAKYGHALCLQKL
LQYNCPTEHADLQGRTALHDAAMADCPSSIQLLCDHGASVNAKDVDGRTPLVLATQMSRP
TICQLLIDRGADVNSRDKQNRTALMLGCEYGCRDAVEVLIKNGADISLLDALGHDSSYYA
RIGDNLDILTLLKTASENTNKGRELWKKGPSLQQRNLTHMQDEVNVKSHQREHQNIQDLE
IENEDLKERLRKIQQEQRILLDKVNGLQLQLNEEVMVADDLESEREKLKSLLAAKEKQHE
ESLRTIEALKNRFKYFESDHLGSGSHFSNRKEDMLLKQGQMYMADSQCTSPGIPAHMQSR
SMLRPLELSLPSQTSYSENEILKKELEAMRTFCESAKQDRLKLQNELAHKVAECKALALE
CERVKEDSDEQIKQLEDALKDVQKRMYESEGKVKQMQTHFLALKEHLTSEAASGNHRLTE
ELKDQLKDLKVKYEGASAEVGKLRNQIKQNEMIVEEFKRDEGKLIEENKRLQKELSMCEM
EREKKGRKVTEMEGQAKELSAKLALSIPAEKFENMKSSLSNEVNEKAKKLVEMEREHEKS
LSEIRQLKRELENVKAKLAQHVKPEEHEQVKSRLEQKSGELGKKITELTLKNQTLQKEIE
KVYLDNKLLKEQAHNLTIEMKNHYVPLKVSEDMKKSHDAIIDDLNRKLLDVTQKYTEKKL
EMEKLLLENDSLSKDVSRLETVFVPPEKHEKEIIALKSNIVELKKQLSELKKKCGEDQEK
IHALTSENTNLKKMMSNQYVPVKTHEEVKMTLNDTLAKTNRELLDVKKKFEDINQEFVKI
KDKNEILKRNLENTQNQIKAEYISLAEHEAKMSSLSQSMRKVQDSNAEILANYRKGQEEI
VTLHAEIKAQKKELDTIQECIKVKYAPIVSFEECERKFKATEKELKDQLSEQTQKYSVSE
EEVKKNKQENDKLKKEIFTLQKDLRDKTVLIEKSHEMERALSRKTDELNKQLKDLSQKYT
EVKNVKEKLVEENAKQTSEILAVQNLLQKQHVPLEQVEALKKSLNGTIENLKEELKSMQR
CYEKEQQTVTKLHQLLENQKNSSVPLAEHLQIKEAFEKEVGIIKASLREKEEESQNKMEE
VSKLQSEVQNTKQALKKLETREVVDLSKYKATKSDLETQISSLNEKLANLNRKYEEVCEE
VLHAKKKEISAKDEKELLHFSIEQEIKDQKERCDKSLTTITELQRRIQESAKQIEAKDNK
ITELLNDVERLKQALNGLSQLTYTSGNPTKRQSQLIDTLQHQVKSLEQQLADADRQHQEV
IAIYRTHLLSAAQGHMDEDVQEALLQIIQMRQGLVC
NT seq 4251 nt   +upstreamnt  +downstreamnt
atgaagagcctcaagtcccgcctgaggaggcaggacgtgcccggccccgcgtcgtctggc
gccgccgccgccagcgcgcatgcagcagattggaataaatatgatgaccgattgatgaaa
gcagcagaaaggggggatgtagaaaaagtgacctcaatccttgctaaaaagggggtcaat
ccaggcaaactagatgtggaaggcagatctgtcttccatgttgtgacctcaaaggggaat
cttgagtgtttgaatgccatccttatacatggagttgatattacaaccagtgacactgca
gggagaaatgctcttcacctggctgctaagtatggacatgcattgtgcctacaaaaactt
ctacagtacaattgtcccactgagcatgcagacctgcagggaagaactgcacttcacgat
gccgcaatggcagattgtccttctagcatacagctgctttgtgaccatggggcctctgtg
aatgccaaagatgtagacgggcggacaccacttgttctggctactcagatgagtaggcca
acaatatgtcaactgctgatagatagaggagcggatgttaattccagagacaaacaaaac
agaactgccctcatgctaggttgcgaatatggttgcagagatgcagtagaagtcttaatt
aaaaatggtgctgatataagcttgctggatgcgcttggccatgatagttcttactatgca
agaattggtgacaatctggacattctaaccttgttgaagactgcatcggaaaataccaac
aaagggagagaactttggaagaaagggccatctttgcaacagcgaaatttgacacacatg
caagatgaagtaaatgtgaagtcacatcagagggagcatcaaaatattcaggatttggag
attgaaaatgaagatttgaaagagaggttgagaaaaattcagcaagaacaaagaatactt
ttggataaagtcaatggtttacagttacagctgaatgaggaagttatggttgctgatgat
ctggaaagcgagagagaaaagctgaagtcccttttggcagctaaagaaaagcaacatgaa
gaaagcttaaggactattgaggctctgaaaaatagatttaaatattttgagagtgatcat
ttaggatcaggaagtcatttcagtaaccgaaaagaagatatgcttcttaaacaaggtcag
atgtatatggcagactcacagtgtacttccccaggtataccagcccatatgcaaagcaga
tctatgttaagacctctggaactatctttacccagtcaaacgtcatactctgaaaatgaa
attttaaagaaagagttagaagcaatgcgaactttctgtgagtcagcaaaacaagaccga
ctgaagctccaaaatgaactggcacacaaagtggcagaatgcaaagctttagcattagaa
tgtgaaagggtcaaggaggattcagatgaacagataaagcaattagaagatgcattaaaa
gatgtgcagaagaggatgtatgagtcagaaggtaaagttaaacaaatgcagacccatttt
cttgcccttaaagaacacttaacaagtgaagcagcctcagggaatcacagactaaccgag
gaactgaaggatcagttgaaagacttgaaagtaaaatatgaaggtgcttcagcagaagtg
gggaaattaagaaaccaaatcaaacaaaatgagatgatagtagaagagtttaagagggat
gaaggcaagctgatagaagaaaataagcgattacagaaggaacttagtatgtgtgaaatg
gagcgagagaagaaaggaagaaaggtcacagagatggaaggccaggcaaaagaattgtca
gcgaagttggccctttccattccagctgaaaaatttgaaaacatgaagagctcattatca
aatgaagtgaatgagaaagcaaaaaaattagtagaaatggaaagagaacatgaaaaatca
cttagtgaaattagacagttaaagagagaacttgagaatgttaaggccaagcttgctcag
cacgtcaaaccagaggaacatgaacaggttaagagcagattagaacagaaatcaggagaa
cttgggaagaagatcactgagttaacattgaaaaatcagacactacaaaaggaaattgaa
aaagtttatttggataataagctcctcaaggagcaagcacataacttaacaattgaaatg
aaaaatcattatgttcctttaaaagtaagtgaagacatgaaaaagtcacatgatgcaatt
attgatgatcttaatagaaagcttttagatgtaacacaaaaatatacagaaaagaagttg
gaaatggagaaattgctactggaaaatgacagcttaagtaaggatgtaagccgcctagaa
actgtgtttgtacctcctgagaaacatgaaaaagagataatagctctgaaatccaatatt
gttgaacttaagaaacagctgtctgaacttaagaaaaaatgtggtgaagaccaggagaaa
atacacgctctcacatctgaaaacactaacttgaagaagatgatgagtaatcagtatgtg
ccagttaaaacccatgaagaggttaaaatgacactgaatgacacgttagccaaaactaac
agagaattattagatgtgaagaaaaaatttgaagatataaatcaggaatttgtaaaaata
aaagataagaatgaaatattaaaaagaaacctggaaaacactcagaaccaaataaaagct
gagtacatcagcctggcagagcacgaggcaaagatgagctcgctaagtcagagcatgaga
aaggtgcaggatagtaatgctgaaatcttggccaactacagaaaaggccaagaagagatt
gtgacactgcatgccgaaattaaagcccagaagaaggagctcgacacaatacaagaatgc
attaaggtaaaatacgccccaattgtcagctttgaggagtgcgagagaaaatttaaagca
acagagaaagaactaaaagaccagttatcagagcagacacaaaagtatagtgtcagtgaa
gaagaagtcaagaaaaacaagcaagagaatgacaagttaaagaaggagatttttaccctt
cagaaagatttgagagataagacagttctcattgagaagtctcatgaaatggaaagagca
ttaagcagaaaaacagacgagctaaacaaacagttaaaagacttgtcacagaaatacacg
gaagtaaagaatgtgaaagagaagctagtagaagaaaatgccaaacagacttctgagata
cttgcagtgcaaaatcttttgcaaaaacaacatgttccattggaacaggttgaggctctg
aaaaaatctcttaatggcacaattgaaaatctaaaggaagaactgaagagtatgcaaagg
tgttacgagaaagagcagcagacagtgaccaaactgcatcaattgttggagaatcaaaag
aactcttctgtacccctggcagagcatttgcagattaaagaagcatttgagaaagaagtt
ggaatcataaaagccagcttgagagaaaaggaagaagaaagccaaaacaaaatggaagaa
gtctccaaacttcagtcggaggttcagaatactaaacaagcattaaaaaaattagagact
agagaggtagttgacttgtctaaatataaagcaacaaaaagtgatttggagacacagatt
tctagcttaaatgaaaaattggccaatctgaatagaaagtatgaggaagtatgtgaggaa
gttttgcatgccaaaaagaaggaaatatctgcaaaagatgagaaggaattactgcatttc
agcattgagcaagaaattaaggatcagaaggaacgatgtgataagtccttaacaacaatc
acagagttacaaagaagaatacaagaatctgctaaacaaatagaagcaaaagataataag
ataactgaactgcttaatgatgtggaaagattaaaacaggcactcaatggcctttcccaa
ctcacctacacaagtgggaaccccaccaagaggcagagccagctgattgacactctgcag
caccaagtgaaatctctggagcaacagctggccgatgctgacagacagcaccaagaagta
attgcaatttatcggacacaccttcttagtgctgcacagggtcacatggatgaagatgtt
caggaggctctgctccagatcatacaaatgcggcaggggcttgtgtgctag

DBGET integrated database retrieval system