KEGG   Homo sapiens (human): 55082
Entry
55082             CDS       T01001                                 
Symbol
ARGLU1
Name
(RefSeq) arginine and glutamate rich 1
  KO
K13173  arginine and glutamate-rich protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    55082 (ARGLU1)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   SR-related proteins
    55082 (ARGLU1)
SSDB
Motif
Pfam: ARGLU
Other DBs
NCBI-GeneID: 55082
NCBI-ProteinID: NP_060481
OMIM: 614046
HGNC: 25482
Ensembl: ENSG00000134884
Pharos: Q9NWB6(Tdark)
UniProt: Q9NWB6 A0A024RDW4
Position
13:complement(106541673..106568137)
AA seq 273 aa
MGRSRSRSSSRSKHTKSSKHNKKRSRSRSRSRDKERVRKRSKSRESKRNRRRESRSRSRS
TNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQE
IEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKRIMEKQLLEELERQR
QAELAAQKAREEEERAKREELERILEENNRKIAEAQAKLAEEQLRIVEEQRKIHEERMKL
EQERQRQQKEEQKIILGKGKSRPKLSFSLKTQD
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggccggtctcggagccggagctcgtcccgctccaagcacaccaagagcagcaagcac
aacaagaagcgcagccggtcccggtcgcgatcccgggacaaggagcgcgtgcggaagcgt
tccaaatctcgggaaagtaaacggaaccggcggcgggagtcgcggtcccgttcgcgctcc
accaacacggccgtgtcccggcgcgagcgggaccgggagcgcgcctcgtccccgcccgac
cgcatcgacatcttcgggcgcacggtgagcaagcgcagcagcctggacgagaagcagaag
cgagaggaggaggagaagaaagcggagttcgagcggcagcgaaaaattcgacagcaagaa
atagaagaaaaactcatcgaggaagaaacagcacgaagagtagaagaattggtagcaaaa
agggtggaggaagaactggagaaaaggaaggatgaaattgaacgagaagttctccgaagg
gtggaggaagccaaacgcatcatggaaaagcagttgctcgaagaactcgagcgacagaga
caagctgagcttgccgcacaaaaagctagagaggaggaagaacgtgcaaaacgtgaggag
ctagagcgaatactggaagagaataaccgaaaaattgcagaagcacaagccaaactggcc
gaagaacagttgagaattgttgaagaacaaagaaagattcatgaggaaaggatgaaacta
gaacaagaacgacaacgtcaacaaaaagaagaacaaaaaattatcctgggcaaggggaag
tccaggccaaaactgtccttctcattaaaaacccaggattaa

DBGET integrated database retrieval system