KEGG   Homo sapiens (human): 55088
Entry
55088             CDS       T01001                                 
Symbol
CCDC186, C10orf118, CCCP-1, CCCP1, golgin104
Name
(RefSeq) coiled-coil domain containing 186
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: TPR_MLP1_2
Other DBs
NCBI-GeneID: 55088
NCBI-ProteinID: NP_001308758
OMIM: 619249
HGNC: 24349
Ensembl: ENSG00000165813
Pharos: Q7Z3E2(Tdark)
UniProt: Q7Z3E2 Q496Y1
Position
10:complement(114120862..114174220)
AA seq 898 aa
MSETDHIASTSSDKNVGKTPELKEDSCNLFSGNESSKLENESKLLSLNTDKTLCQPNEHN
NRIEAQENYIPDHGGGEDSCAKTDTGSENSEQIANFPSGNFAKHISKTNETEQKVTQILV
ELRSSTFPESANEKTYSESPYDTDCTKKFISKIKSVSASEDLLEEIESELLSTEFAEHRV
PNGMNKGEHALVLFEKCVQDKYLQQEHIIKKLIKENKKHQELFVDICSEKDNLREELKKR
TETEKQHMNTIKQLESRIEELNKEVKASRDQLIAQDVTAKNAVQQLHKEMAQRMEQANKK
CEEARQEKEAMVMKYVRGEKESLDLRKEKETLEKKLRDANKELEKNTNKIKQLSQEKGRL
HQLYETKEGETTRLIREIDKLKEDINSHVIKVKWAQNKLKAEMDSHKETKDKLKETTTKL
TQAKEEADQIRKNCQDMIKTYQESEEIKSNELDAKLRVTKGELEKQMQEKSDQLEMHHAK
IKELEDLKRTFKEGMDELRTLRTKVKCLEDERLRTEDELSKYKEIINRQKAEIQNLLDKV
KTADQLQEQLQRGKQEIENLKEEVESLNSLINDLQKDIEGSRKRESELLLFTERLTSKNA
QLQSESNSLQSQFDKVSCSESQLQSQCEQMKQTNINLESRLLKEEELRKEEVQTLQAELA
CRQTEVKALSTQVEELKDELVTQRRKHASSIKDLTKQLQQARRKLDQVESGSYDKEVSSM
GSRSSSSGSLNARSSAEDRSPENTGSSVAVDNFPQVDKAMLIERIVRLQKAHARKNEKIE
FMEDHIKQLVEEIRKKTKIIQSYILREESGTLSSEASDFNKVHLSRRGGIMASLYTSHPA
DNGLTLELSLEINRKLQAVLEDTLLKNITLKENLQTLGTEIERLIKHQHELEQRTKKT
NT seq 2697 nt   +upstreamnt  +downstreamnt
atgtcagagacagaccacatagcctctacttcctctgataaaaatgttgggaaaacacct
gaattaaaggaagactcatgcaacttgttttctggcaatgaaagcagcaaattagaaaat
gagtccaaactattgtcattaaacactgataaaactttatgtcaacctaatgagcataat
aatcgaattgaagcccaggaaaattatattccagatcatggtggaggtgaggattcttgt
gccaaaacagacacaggctcagaaaattctgaacaaatagctaattttcctagtggaaat
tttgctaaacatatttcaaaaacaaatgaaacagaacagaaagtaacacaaatattggtg
gaattaaggtcatctacatttccagaatcagctaatgaaaagacttattcagaaagcccc
tatgatacagactgcaccaagaaatttatttcaaaaataaagagcgtttcagcatcagag
gatttgttggaagaaatagaatctgagctcttatctacggagtttgcagaacatcgagta
ccaaatggaatgaataagggagaacatgcattagttctgtttgaaaagtgtgtgcaagat
aaatatttgcagcaggaacatatcataaaaaagttaattaaagaaaataagaagcatcag
gagctcttcgtagacatttgttcagaaaaagacaatttaagagaagaactaaagaaaaga
acagaaactgagaagcagcatatgaacacaattaaacagttagaatcaagaatagaagaa
cttaataaagaagttaaagcttccagagatcaactaatagctcaagacgttacagctaaa
aatgcagttcagcagttacacaaagagatggcccaacggatggaacaggccaacaagaaa
tgtgaagaggcacgccaagaaaaagaagcaatggtaatgaaatatgtaagaggtgagaag
gaatctttagatcttcgaaaggaaaaagagacacttgagaaaaaacttagagatgcaaat
aaggaacttgagaaaaacactaacaaaattaagcagctttctcaggagaaaggacggttg
caccagctgtatgaaactaaggaaggcgaaacgactagactcatcagagaaatagacaaa
ttaaaggaagacattaactctcacgtcatcaaagtaaagtgggcacaaaacaaattaaaa
gctgaaatggattcacacaaggaaaccaaagataaactcaaagaaacaacaacaaaatta
acacaagcaaaggaagaagcagatcagatacgaaaaaactgtcaggatatgataaaaaca
tatcaggagtcagaagaaattaaatcaaatgagcttgatgcaaagcttagagtcacaaaa
ggagaacttgaaaaacaaatgcaagaaaaatctgaccagctagagatgcatcatgccaaa
ataaaggaactagaagatctgaagagaacatttaaggagggtatggatgagttaagaaca
ctgagaacaaaggtgaaatgtctagaagatgaacgattaagaacagaagatgaattatca
aaatataaggaaattattaatcgccaaaaagctgaaattcagaatttattggacaaggtg
aaaactgcagatcagctacaggagcagcttcaaagaggtaagcaagaaattgaaaatttg
aaagaagaagtggaaagtcttaattctttgattaatgacctacaaaaagacatcgaaggc
agtaggaaaagagaatctgagctgctgctgtttacagaaaggctcactagtaagaatgca
cagcttcagtctgaatccaattctttgcagtcacaatttgataaagtttcctgtagtgaa
agtcagttacaaagccagtgtgaacaaatgaaacagacaaatattaatttggaaagtagg
ttgttgaaagaggaagaactgcgaaaagaggaagtccaaactctgcaagctgaactcgct
tgtagacaaacagaagttaaagcattgagtacccaggtagaagaattaaaagatgagtta
gtaactcagagacgtaaacatgcctctagtatcaaggatctcaccaaacaacttcagcaa
gcacgaagaaaattagatcaggttgagagtggaagctatgacaaagaagtcagcagcatg
ggaagtcgttctagttcatcagggtccctgaatgctcgaagcagtgcagaagatcgatct
ccagaaaatactgggtcctcagtagctgtggataactttccacaagtagataaggccatg
ttgattgagagaatagttaggctgcaaaaagcacatgcccggaaaaatgaaaagatagaa
tttatggaggaccacatcaaacaactggtggaagaaattaggaaaaaaacaaaaataatt
caaagttatattttacgagaagaatcaggcacactttcttcagaggcatctgattttaac
aaagttcatttaagtagacggggtggcatcatggcatctttatatacatcccatccagct
gacaatggattaacattggagctctctttggaaatcaaccgaaaattacaggctgttttg
gaggatacgttactaaaaaatattactttgaaggaaaatctacaaacacttggaacagaa
atagaacgtcttattaaacaccagcatgaactagaacagaggacaaagaaaacctaa

DBGET integrated database retrieval system