KEGG   Homo sapiens (human): 55093
Entry
55093             CDS       T01001                                 

Gene name
NTAQ1, C8orf32, WDYHV1
Definition
(RefSeq) N-terminal glutamine amidase 1
  KO
K21286  protein N-terminal glutamine amidohydrolase [EC:3.5.1.122]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    55093 (NTAQ1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.122  protein N-terminal glutamine amidohydrolase
     55093 (NTAQ1)
Motif
Pfam: Nt_Gln_amidase
Other DBs
NCBI-GeneID: 55093
NCBI-ProteinID: NP_060494
HGNC: 25490
Ensembl: ENSG00000156795
Vega: OTTHUMG00000165093
Pharos: Q96HA8(Tdark)
UniProt: Q96HA8
Structure
PDB: 
4W79 3C9Q

Position
8q24.13
AA seq 205 aa
MEGNGPAAVHYQPASPPRDACVYSSCYCEENIWKLCEYIKNHDQYPLEECYAVFISNERK
MIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQNFIYDLDTVLPFPCLFDTYVEDAFKSDD
DIHPQFRRKFRVIRADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFIS
MDPKVGWGAVYTLSEFTHRFGSKNC
NT seq 618 nt   +upstreamnt  +downstreamnt
atggaaggtaatggccccgctgctgtccactaccagccggccagccccccgcgggacgcc
tgcgtctacagcagctgctactgtgaagaaaatatttggaagctctgtgaatacatcaaa
aaccatgaccagtatcctttagaagaatgttatgctgtcttcatatctaatgagaggaag
atgatacctatctggaaacaacaggcgagacctggagatggacctgtgatctgggattac
catgttgttttgcttcatgtttcaagtggaggacagaacttcatttatgatctcgatact
gtcttgccatttccctgcctctttgacacttatgtagaagatgcctttaagtctgatgat
gacattcacccacagtttaggaggaaatttagagtgatccgtgcagattcatatttgaag
aactttgcttctgaccgatctcacatgaaagactccagtgggaattggagagagcctccg
ccgccatatccctgcattgagactggagattccaaaatgaacctgaacgatttcatcagt
atggatcccaaggtaggatggggcgccgtctacacactatccgaatttacacatcggttt
ggcagtaaaaactgctga

DBGET integrated database retrieval system