KEGG   Homo sapiens (human): 551Help
Entry
551               CDS       T01001                                 

Gene name
AVP, ADH, ARVP, AVP-NPII, AVRP, VP
Definition
(RefSeq) arginine vasopressin
  KO
K05242  arginine vasopressin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04962  Vasopressin-regulated water reabsorption
Disease
H00253  Neurohypophyseal diabetes insipidus (NPDI)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    551 (AVP)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    551 (AVP)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    551 (AVP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_5 Hormone_4
Motif
Other DBs
NCBI-GeneID: 551
NCBI-ProteinID: NP_000481
OMIM: 192340
HGNC: 894
Ensembl: ENSG00000101200
Vega: OTTHUMG00000031733
Pharos: P01185(Tbio)
CPD: C16078 C13662
UniProt: P01185 X5DQP6
Position
20p13
AA seq 164 aa AA seqDB search
MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCA
DELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGF
HRRARASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacaccatgctgcccgcctgcttcctcggcctactggccttctcctccgcgtgc
tacttccagaactgcccgaggggcggcaagagggccatgtccgacctggagctgagacag
tgcctcccctgcggccccgggggcaaaggccgctgcttcgggcccagcatctgctgcgcg
gacgagctgggctgcttcgtgggcacggctgaggcgctgcgctgccaggaggagaactac
ctgccgtcgccctgccagtccggccagaaggcgtgcgggagcgggggccgctgcgccgcc
ttcggcgtttgctgcaacgacgagagctgcgtgaccgagcccgagtgccgcgagggcttt
caccgccgcgcccgcgccagcgaccggagcaacgccacgcagctggacgggccggccggg
gccttgctgctgcggctggtgcagctggccggggcgcccgagcccttcgagcccgcccag
cccgacgcctactga

DBGET integrated database retrieval system