KEGG   Homo sapiens (human): 55109Help
Entry
55109             CDS       T01001                                 

Gene name
AGGF1, GPATC7, GPATCH7, HSU84971, HUS84971, VG5Q
Definition
(RefSeq) angiogenic factor with G-patch and FHA domains 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: FHA G-patch G-patch_2 Yop-YscD_cpl DUF745 IncA BST2 HCMV_UL139 Laminin_II Bcr-Abl_Oligo DUF3450 Pox_A_type_inc
Motif
Other DBs
NCBI-GeneID: 55109
NCBI-ProteinID: NP_060516
OMIM: 608464
HGNC: 24684
Ensembl: ENSG00000164252
Vega: OTTHUMG00000102132
Pharos: Q8N302(Tbio)
UniProt: Q8N302
Position
5q13.3
AA seq 714 aa AA seqDB search
MASEAPSPPRSPPPPTSPEPELAQLRRKVEKLERELRSCKRQVREIEKLLHHTERLYQNA
ESNNQELRTQVEELSKILQRGRNEDNKKSDVEVQTENHAPWSISDYFYQTYYNDVSLPNK
VTELSDQQDQAIETSILNSKDHLQVENDAYPGTDRTENVKYRQVDHFASNSQEPASALAT
EDTSLEGSSLAESLRAAAEAAVSQTGFSYDENTGLYFDHSTGFYYDSENQLYYDPSTGIY
YYCDVESGRYQFHSRVDLQPYPTSSTKQSKDKKLKKKRKDPDSSATNEEKDLNSEDQKAF
SVEHTSCNEEENFANMKKKAKIGIHHKNSPPKVTVPTSGNTIESPLHENISNSTSFKDEK
IMETDSEPEEGEITDSQTEDSYDEAITSEGNVTAEDSEDEDEDKIWPPCIRVIVIRSPVL
QIGSLFIITAVNPATIGREKDMEHTLRIPEVGVSKFHAEIYFDHDLQSYVLVDQGSQNGT
IVNGKQILQPKTKCDPYVLEHGDEVKIGETVLSFHIHPGSDTCDGCEPGQVRAHLRLDKK
DESFVGPTLSKEEKELERRKELKKIRVKYGLQNTEYEDEKTLKNPKYKDRAGKRREQVGS
EGTFQRDDAPASVHSEITDSNKGRKMLEKMGWKKGEGLGKDGGGMKTPIQLQLRRTHAGL
GTGKPSSFEDVHLLQNKNKKNWDKARERFTENFPETKPQKDDPGTMPWVKGTLE
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggaggcgccgtccccgccgcggtcgccgccgccgcccacctcccccgagcct
gagctggcccagctaaggcggaaggtggagaagttggaacgtgaactgcggagctgcaag
cggcaggtgcgggagatcgagaagctgctgcatcacacagaacggctgtaccagaacgca
gaaagcaacaaccaggagctccgcacgcaggtggaagaactcagtaaaatactccaacgt
gggagaaatgaagataataaaaagtctgatgtagaagtacaaacagagaaccatgctcct
tggtcaatctcagattatttttatcagacgtactacaatgacgttagtcttccaaataaa
gtgactgaactgtcagatcaacaagatcaagctatcgaaacttctattttgaattctaaa
gaccatttacaagtagaaaatgatgcttaccctggtaccgatagaacagaaaatgttaaa
tatagacaagtggaccattttgcctcaaattcacaggagccagcatctgcattagcaaca
gaagatacctccttagaaggctcatcattagctgaaagtttgagagctgcagcagaagcg
gctgtatcacagactggatttagttatgatgaaaatactggactgtattttgaccacagc
actggtttctattatgattctgaaaatcaactctattatgatccttccactggaatttat
tactattgtgatgtggaaagtggtcgttatcagtttcattctcgagtagatttgcaacct
tatccgacttctagcacaaaacaaagtaaagataaaaaattgaagaagaaaagaaaagat
ccagattcttctgcaacaaatgaggaaaaggatttgaactcagaggatcaaaaagccttc
agtgttgaacatacaagctgcaatgaggaagaaaatttcgcaaatatgaaaaagaaggcc
aaaataggcattcatcacaaaaatagtccccccaaagtcactgttccaactagtggaaat
actatagagtctcctcttcatgaaaacatctctaattcaacatcatttaaagatgagaaa
atcatggagactgatagtgaaccagaggaaggtgaaattacagactctcagactgaggat
agttatgacgaagccattaccagtgaaggcaatgtaactgcagaagatagtgaggatgaa
gatgaagacaaaatttggcccccatgtattagagtaattgtcattagatcacctgtgttg
cagataggatcactctttatcattactgctgtaaaccctgctacaattggaagagaaaag
gatatggaacatactctccgaatccctgaagttggtgtcagtaagtttcatgcagaaatt
tattttgaccatgacttacaaagttatgtccttgtggatcaaggcagtcaaaatggcaca
attgttaatggaaaacagattcttcagccgaaaactaaatgtgacccttacgtacttgag
catggagatgaagtcaaaattggagaaactgtcttatcctttcacattcatcctggcagt
gatacctgtgatggctgtgaaccagggcaggttagagcccaccttcgccttgataagaaa
gatgaatcttttgttggtccaacactaagtaaggaggaaaaagagttggaaagaagaaaa
gaattaaagaaaatacgagtaaaatatggtttacagaatacagaatacgaagatgaaaag
acattgaagaatccaaaatataaagatagagctggaaaacgtagggagcaggttggaagt
gaaggaactttccaaagagatgatgctcctgcatctgttcattctgaaattactgatagc
aacaaaggtcggaagatgttggagaagatgggttggaagaaaggagagggcctggggaag
gatggtggaggaatgaaaacgccgatccagcttcagcttcggcgaacacatgcaggcttg
gggacaggcaaaccatcctcatttgaagatgttcaccttctccaaaacaagaacaaaaaa
aactgggacaaagcacgagagcggtttactgaaaacttcccagaaactaagcctcaaaaa
gatgacccagggaccatgccttgggtaaaagggactttagagtga

DBGET integrated database retrieval system