KEGG   Homo sapiens (human): 55135Help
Entry
55135             CDS       T01001                                 

Gene name
WRAP53, DKCB3, TCAB1, WDR79
Definition
(RefSeq) WD repeat containing antisense to TP53
  KO
K23314  telomerase Cajal body protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00507  Dyskeratosis congenita
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    55135 (WRAP53)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    55135 (WRAP53)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     55135 (WRAP53)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Others
     55135 (WRAP53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 55135
NCBI-ProteinID: NP_001137462
OMIM: 612661
HGNC: 25522
Ensembl: ENSG00000141499
Vega: OTTHUMG00000134323
Pharos: Q9BUR4(Tbio)
UniProt: Q9BUR4
Position
17p13.1
AA seq 548 aa AA seqDB search
MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAG
SAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANG
PELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPD
GSCILTNSADNILRIYNLPPELYHEGEQVEYAEMVPVLRMVEGDTIYDYCWYSLMSSAQP
DTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTV
RVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLYACGSYGRSLGLYAWDDGSPL
ALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFD
LDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATAS
GQRVFPEPTESGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGT
EGGVGELI
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttggagactcaaccgttagctccggactgctgtccttcagaccaggaccca
gctccagcccatccttctccccacgcttccccgatgaataaaaatgcggactctgaactg
atgccaccgcctcccgaaaggggggatccgccccggttgtccccagatcctgtggctggc
tcagctgtgtcccaggagctacgggagggggacccagtttctctctccactcccctggaa
acagagtttggttcccctagtgagttgagtcctcgaatcgaggagcaagaactttctgaa
aatacaagccttcctgcagaagaagcaaacgggagcctttctgaagaagaagcgaacggg
ccagagttggggtctggaaaagccatggaagatacctctggggaacccgctgcagaggac
gagggagacaccgcttggaactacagcttctcccagctgcctcgatttctcagtggttcc
tggtcagagttcagcacccaacctgagaacttcttgaaaggctgtaagtgggctcctgac
ggttcctgcatcttgaccaatagtgctgataacatcttgcgaatttataacctgccccca
gagctgtaccatgagggggagcaggtggaatatgcagaaatggtccctgtccttcgaatg
gtggaaggtgataccatctatgattactgctggtattctctgatgtcctcagcccagcca
gacacctcctacgtggccagcagcagccgggagaacccgattcatatctgggacgcattc
actggagagctccgggcttcctttcgcgcctacaaccacctggatgagctgacggcagcc
cattcgctctgcttctccccggatggctcccagctcttctgtggcttcaaccggactgtg
cgtgttttttccacggcccggcctggccgagactgcgaggtccgagccacatttgcaaaa
aagcagggccagagcggcatcatctcctgcatagccttcagcccagcccagcccctctat
gcctgtggctcctacggccgctccctgggtctgtatgcctgggatgatggctcccctctc
gccttgctgggagggcaccaagggggcatcacccacctctgctttcatcccgatggcaac
cgcttcttctcaggagcccgcaaggatgctgagctcctgtgctgggatctccggcagtct
ggttacccactgtggtccctgggtcgagaggtgaccaccaatcagcgcatctacttcgat
ctggacccgaccgggcagttcctagtgagtggcagcacgagcggggctgtctctgtgtgg
gacacggacgggcctggcaatgatgggaagccggagcccgtgttgagttttctgccccag
aaggactgcaccaatggcgtgagcctgcaccctagcctgcctctcctggccactgcctcc
ggtcagcgtgtgtttcctgagcccacagagagtggggacgaaggagaggagctgggcctt
cccttgctctccacgcgccacgtccaccttgaatgtcggcttcagctctggtggtgtggg
ggggcgccagactccagcatccctgatgatcaccagggcgagaaagggcagggaggaacg
gagggaggtgtgggtgagctgatataa

DBGET integrated database retrieval system