KEGG   Homo sapiens (human): 55139Help
Entry
55139             CDS       T01001                                 

Gene name
ANKZF1, Vms1, ZNF744
Definition
(RefSeq) ankyrin repeat and zinc finger peptidyl tRNA hydrolase 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: bVLRF1 VATC Ank_2 Ank_5 Ank_3 Ank Ank_4 zf-ribbon_3
Motif
Other DBs
NCBI-GeneID: 55139
NCBI-ProteinID: NP_001035869
OMIM: 617541
HGNC: 25527
Ensembl: ENSG00000163516
Vega: OTTHUMG00000154533
Pharos: Q9H8Y5(Tdark)
UniProt: Q9H8Y5
Position
2q35
AA seq 726 aa AA seqDB search
MSPAPDAAPAPASISLFDLSADAPVFQGLSLVSHAPGEALARAPRTSCSGSGERESPERK
LLQGPMDISEKLFCSTCDQTFQNHQEQREHYKLDWHRFNLKQRLKDKPLLSALDFEKQSS
TGDLSSISGSEDSDSASEEDLQTLDRERATFEKLSRPPGFYPHRVLFQNAQGQFLYAYRC
VLGPHQDPPEEAELLLQNLQSRGPRDCVVLMAAAGHFAGAIFQGREVVTHKTFHRYTVRA
KRGTAQGLRDARGGPSHSAGANLRRYNEATLYKDVRDLLAGPSWAKALEEAGTILLRAPR
SGRSLFFGGKGAPLQRGDPRLWDIPLATRRPTFQELQRVLHKLTTLHVYEEDPREAVRLH
SPQTHWKTVREERKKPTEEEIRKICRDEKEALGQNEESPKQGSGSEGEDGFQVELELVEL
TVGTLDLCESEVLPKRRRRKRNKKEKSRDQEAGAHRTLLQQTQEEEPSTQSSQAVAAPLG
PLLDEAKAPGQPELWNALLAACRAGDVGVLKLQLAPSPADPRVLSLLSAPLGSGGFTLLH
AAAAAGRGSVVRLLLEAGADPTVQDSRARPPYTVAADKSTRNEFRRFMEKNPDAYDYNKA
QVPGPLTPEMEARQATRKREQKAARRQREEQQQRQQEQEEREREEQRRFAALSDREKRAL
AAERRLAAQLGAPTSPIPDSAIVNTRRCWSCGASLQGLTPFHYLDFSFCSTRCLQDHRRQ
AGRPSS
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccggctccagatgcagccccggctcctgcgtcgatctccctgtttgacctcagc
gcggatgctccggtctttcagggcctgagcctggtgagccacgcgcctggggaggctctg
gcccgggctccgcgtacttcctgttcaggctcaggggagagagaaagcccagaaagaaag
ctactccagggtcctatggatatttcagagaagttattttgttcaacttgtgaccagacc
ttccagaaccaccaagaacagagggaacattataagcttgactggcatcggtttaaccta
aagcaacgtctcaaggacaagcctctcctgtctgccctggactttgaaaagcagagctcc
acaggagatctttccagcatctcgggatcagaagactcagactcagccagtgaggaggac
ttgcagacactggatcgggagagggctacatttgagaagttgagccgacccccaggcttt
taccctcatcgagttcttttccagaatgcccagggccagtttctttatgcctaccgctgt
gtcctaggccctcatcaggatcccccagaagaggcagaactgctgctacagaacctgcaa
agtagaggtcccagagactgcgtggtgctcatggctgcagctgggcactttgctggtgct
atatttcaaggaagagaagtggtgacacacaaaacttttcaccgctatacggttcgggcc
aagcggggcacagcccaggggcttcgggatgcccgaggtgggccatcacactctgctgga
gccaacctgaggcgctacaatgaagccacactatataaggatgttcgtgacctgctggca
gggccaagctgggctaaggcgctggaggaggctggtacaatactgttgcgtgctccccgc
tctggccggtctttgttctttggaggcaagggagcacccctgcaaaggggggatccccga
ctttgggatatccccctcgccacccgcagacccaccttccaagagctacagcgtgtgctc
cataagctgaccactttgcatgtctatgaagaagaccctcgggaagcagtcagactgcac
tcacctcagacacactggaaaacagtaagagaggagagaaagaagcctactgaggaagaa
ataagaaagatctgcagggatgaaaaggaagcgctggggcagaatgaggaatctcccaaa
cagggttcagggtcggagggagaagatggctttcaggtagagttggagctagtggagttg
actgtggggactctggatctttgtgagtctgaagtattgcccaagcggaggaggagaaaa
aggaataagaaggagaaaagccgagaccaggaggctggggcacatcggactcttctccag
caaactcaagaagaggagccttccacacagtcatcccaggcagttgctgcccccttgggc
cctttgctggatgaggccaaagcccctggtcagccagagctctggaatgcactgcttgct
gcttgccgagctggagatgttggagtgctaaagctgcagctagctcccagccctgcagac
cctagagttctgtctctgctcagtgcccccttgggctccggtggctttactctcctgcat
gcagcagctgcagctggaagaggctcagtggttcgtctgctgctggaagcaggtgctgac
cccactgtgcaggactctcgggcccggccaccttatactgttgcggctgacaaatcaaca
cgtaatgagttccgaaggttcatggagaagaatccagatgcctacgattacaacaaggct
caggtgccaggaccattgacaccagaaatggaggcacggcaggctacacggaaaagggag
cagaaggcagcccggcggcaacgggaggaacagcagcagaggcagcaggagcaggaggag
cgtgaacgagaagagcagcggcgatttgccgccctcagtgaccgagagaagagagctctg
gctgcagagcgccgactcgctgcccagttgggagcccctacctctccaatccctgactct
gcaatcgtcaatactcgacgctgctggagttgtggggcatccctccaaggcctgactccc
tttcactacctcgacttctctttctgctccacacgttgcctccaggatcatcgccgtcag
gcagggaggccctcttcctga

DBGET integrated database retrieval system