KEGG   Homo sapiens (human): 5514
Entry
5514              CDS       T01001                                 

Gene name
PPP1R10, CAT53, FB19, PNUTS, PP1R10, R111, p99
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 10
  KO
K17552  protein phosphatase 1 regulatory subunit 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5514 (PPP1R10)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5514 (PPP1R10)
SSDB
Motif
Pfam: Med26 zf-CCCH zf-CCCH_4 zf-CCCH_2 zf_CCCH_4
Other DBs
NCBI-GeneID: 5514
NCBI-ProteinID: NP_002705
OMIM: 603771
HGNC: 9284
Ensembl: ENSG00000204569
Vega: OTTHUMG00000031259
Pharos: Q96QC0(Tbio)
UniProt: Q96QC0 Q2L6I0
Position
6p21.33
AA seq 940 aa
MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSP
EILVKFIDVGGYKLLNNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQL
SKSSEDEELRKLASVLVSDWMAVIRSQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKA
ETRAEEAPEKKREKPKSLRTTAPSHAKFRSTGLELETPSLVPVKKNASTVVVSDKYNLKP
IPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDALNSAPV
PGIKIKKKKKVLSPTAAKPSPFEGKTSTEPSTAKPSSPEPAPPSEAMDADRPGTPVPPVE
VPELMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETER
VNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWVCPRPLVLPSPLVTPGSNS
QERYIQAEREKGILQELFLNKESPHEPDPEPYEPIPPKLIPLDEECSMDETPYVETLEPG
GSGGSPDGAGGSKLPPVLANLMGSMGAGKGPQGPGGGGINVQEILTSIMGSPNSHPSEEL
LKQPDYSDKIKQMLVPHGLLGPGPIANGFPPGGPGGPKGMQHFPPGPGGPMPGPHGGPGG
PVGPRLLGPPPPPRGGDPFWDGPGDPMRGGPMRGGPGPGPGPYHRGRGGRGGNEPPPPPP
PFRGARGGRSGGGPPNGRGGPGGGMVGGGGHRPHEGPGGGMGNSSGHRPHEGPGGGMGSG
HRPHEGPGGSMGGGGGHRPHEGPGGGISGGSGHRPHEGPGGGMGAGGGHRPHEGPGGSMG
GSGGHRPHEGPGHGGPHGHRPHDVPGHRGHDHRGPPPHEHRGHDGPGHGGGGHRGHDGGH
SHGGDMSNRPVCRHFMMKGNCRYENNCAFYHPGVNGPPLP
NT seq 2823 nt   +upstreamnt  +downstreamnt
atgggttcgggtcccatagaccccaaagaacttctcaagggcctggacagcttccttaac
cgagatggggaagtcaaaagtgtggatgggatttccaagatcttcagtttgatgaaggaa
gcacgaaagatggtgagtcgatgcacttacttgaacattctcctgcagacccgttcacca
gaaatattggtcaaatttattgacgttggcggctacaaacttcttaacaattggctgacg
tattcaaagacaaccaacaacattcccctcctccagcaaattctactgaccctgcagcat
ctaccgctcactgtagaccatctcaagcagaacaacacagctaaactggtgaagcagctg
agcaagtcaagtgaggatgaagagctccggaaattggcctcagtccttgtcagcgactgg
atggctgtcatccgctctcagagcagtacccagcctgctgagaaagataagaagaaacgt
aaagatgaaggaaaaagtcgaactacccttcctgagcgacctttgacagaggtgaaggct
gagacccgggctgaggaggccccagagaagaagagggagaagcccaagtctcttcgcacc
acagcacccagtcatgccaagttccgttccactggactagagctggagacaccatccttg
gtgcctgtgaagaagaatgccagcacagtggtggtttctgacaagtacaaccttaaaccc
atccccctcaaacgtcagagcaacgtagctgctccaggagatgccactccccctgcagag
aagaaatacaagccactcaacacaacacctaatgccaccaaagagatcaaagtgaagatc
atcccgccacagcctatggagggcctgggctttctggatgctcttaattcagcccctgtt
ccaggcatcaaaattaagaagaaaaaaaaagtactgtcacctacggctgccaagccaagc
ccctttgaagggaaaacgagcacagaaccaagcacagccaaaccttcttccccagaacca
gcaccaccttctgaggcaatggacgcagaccgtccaggcaccccggttccccctgttgaa
gtcccggagctcatggatacagcctctttggagccaggagctctggatgccaagccagtg
gagagtcctggagatcctaaccaactgacccggaaaggcaggaagaggaaaagtgtgaca
tggcctgaggaaggcaaactgagagaatatttctattttgaattggatgaaactgaacga
gtaaatgtgaataagatcaaggactttggtgaggcggctaagcgagagatactgtcagac
cgacatgcatttgagacagcgcggcgtctgagccatgataacatggaggagaaggtgccc
tgggtgtgcccccggcccctggttctgccctcacctcttgtcacccctggaagcaatagt
caggagcgatatatccaggctgagcgggagaagggaatccttcaggagctcttcctgaac
aaggagagtcctcatgagcctgatcctgagccctacgagcccataccccctaaactcatc
cccctagatgaggagtgttccatggatgagactccgtatgttgagactctggaacctggg
gggtcaggtggctcacctgatggggcaggaggctccaagttgcctccagttctggccaat
cttatgggaagcatgggtgctggaaagggcccccaaggccctggaggaggaggcattaat
gtccaagagatcctcacctccatcatgggtagcccaaacagtcatccttcagaggaacta
ctgaaacaaccagactattcggacaagatcaagcagatgctggtgccacatggactccta
ggccctggcccaatagccaatggtttcccaccagggggtcctgggggccccaagggcatg
cagcactttccccctggacctgggggacctatgccaggtccccatggaggccctggtggg
ccagtgggtccacgtcttctgggtcctccaccccctccccggggaggtgatcccttctgg
gatggcccgggcgaccctatgcggggtggcccaatgcgggggggtccaggaccaggtcct
ggaccataccatagaggccgaggtggccgaggaggaaacgaacctcctcctcctcctcct
ccattccgaggcgccagaggaggtcgctctggaggaggacccccaaatggacgagggggc
cctggtgggggcatggttggaggtggtgggcatcgtcctcacgaaggccctggtgggggc
atgggcaacagcagtggacatcgtccccacgaaggccctggcggtggcatgggaagtggg
catcgcccccatgaaggccctggtggtagcatgggtgggggtggaggacatcgtccccac
gaaggccctggcggtggcatcagtggtggcagtggccatcgtccccatgaaggccctggc
ggaggaatgggtgccggtggtggacatcgcccccacgaaggccctggcggaagcatgggt
ggaagtggtggacatcgtccccatgaaggccctggacacggggggccccatggccaccgg
cctcatgatgtccctggtcaccgaggccatgaccatcgagggccgccacctcatgagcac
cgtggccatgatggtcctggccacgggggagggggccaccgagggcacgatggaggccac
agccatggaggagacatgtcaaaccgccctgtctgccgacatttcatgatgaagggcaac
tgccgctatgagaacaactgtgccttctaccacccgggtgtcaatgggccccccctgccc
tag

DBGET integrated database retrieval system