KEGG   Homo sapiens (human): 55148
Entry
55148             CDS       T01001                                 
Symbol
UBR7, C14orf130, LICAS
Name
(RefSeq) ubiquitin protein ligase E3 component n-recognin 7
  KO
K11979  E3 ubiquitin-protein ligase UBR7 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    55148 (UBR7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     55148 (UBR7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   UBR box proteins
    55148 (UBR7)
SSDB
Motif
Pfam: zf-UBR PHD
Other DBs
NCBI-GeneID: 55148
NCBI-ProteinID: NP_786924
OMIM: 613816
HGNC: 20344
Ensembl: ENSG00000012963
Pharos: Q8N806(Tdark)
UniProt: Q8N806
Position
14:93207256..93229215
AA seq 425 aa
MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYA
CSTCTPEGEEPAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKNLECKLLPDKAKV
NSGNKYNDNFFGLYCICKRPYPDPEDEIPDEMIQCVVCEDWFHGRHLGAIPPESGDFQEM
VCQACMKRCSFLWAYAAQLAVTKISTEDDGLVRNIDGIGDQEVIKPENGEHQDSTLKEDV
PEQGKDDVREVKVEQNSEPCAGSSSESDLQTVFKNESLNAESKSGCKLQELKAKQLIKKD
TATYWPLNWRSKLCTCQDCMKMYGDLDVLFLTDEYDTVLAYENKGKIAQATDRSDPLMDT
LSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKREDIQQFFEEFQSKKRRRVDGM
QYYCS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggccggagccgagggcgccgctgggcggcagtcggagctggagcccgtggtatcgttg
gtcgacgtccttgaggaggacgaggagctggagaatgaggcgtgcgctgtcctgggcggc
agcgactccgagaagtgctcctactctcagggctcagtaaagagacaagcactatatgcc
tgtagtacctgcaccccagagggagaagaaccagcaggaatttgtttagcttgcagttat
gaatgtcatggaagtcacaaactatttgagctatacacaaaaagaaattttcgttgtgat
tgtggaaacagcaagtttaaaaatttggaatgcaaattacttcctgacaaagcaaaggta
aattctggcaataagtacaatgacaacttttttggattgtactgcatttgcaagagacct
tatcctgatcctgaagacgagattccagatgagatgatccagtgcgtagtctgtgaagac
tggttccatggaaggcatcttggtgccattccccctgagagtggggattttcaggagatg
gtatgccaggcctgcatgaaacgttgttcttttttgtgggcttatgctgcacaattggca
gtaaccaaaatatccactgaggatgatggattggtgcggaacattgatggaataggtgat
caggaagttatcaaacctgaaaatggagagcatcaagatagtaccctcaaagaggatgtt
ccagaacagggaaaggatgatgtccgggaggttaaagtagagcagaacagtgaaccatgt
gccggctctagttctgaatctgatctccagacagtgtttaagaatgaaagcctcaacgca
gaatcaaaatctggctgcaaacttcaggagcttaaagctaagcagcttataaagaaagac
actgccacctattggcccctgaactggcgtagcaagttgtgtacctgccaagactgtatg
aaaatgtatggagatctagatgtcttattcctgacagatgaatacgacacagttctggct
tatgaaaacaaagggaagattgcccaggccactgacaggagcgatcccctaatggatacc
cttagcagcatgaatagagtccagcaagtggaactcatttgtgaatacaatgatttgaag
actgaacttaaagactatctcaagagatttgctgatgaaggcacggttgttaagagagag
gacattcagcagttctttgaagagtttcagtcaaaaaagagaagaagagtggatgggatg
cagtattactgcagctag

DBGET integrated database retrieval system