KEGG   Homo sapiens (human): 55156
Entry
55156             CDS       T01001                                 
Symbol
ARMC1, Arcp
Name
(RefSeq) armadillo repeat containing 1
  KO
K17306  armadillo repeat-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    55156 (ARMC1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   55156 (ARMC1)
SSDB
Motif
Pfam: Arm HMA
Other DBs
NCBI-GeneID: 55156
NCBI-ProteinID: NP_060590
OMIM: 620385
HGNC: 17684
Ensembl: ENSG00000104442
UniProt: Q9NVT9
Position
8:complement(65602458..65634177)
AA seq 282 aa
MNSSTSTMSEEPDALSVVNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSAL
LALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNMADGDS
FNEMNSRRRKAQFFLGTTNKRAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAV
QRCVVRIRSDLKAEALASAIASTKVMKAQQVVKSESGEEMLVPFQDTPVEVEQNTELPDY
LPEDESPTKEQDKAVSRVGSHPEGGASWLSTAANFLSRSFYW
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaattcttccacttccaccatgagtgaagagcctgacgctctatcggtagttaaccag
ttacgggatctagcagcagatccgttaaacagaagagccatcgtccaggatcagggatgt
ctgcctggccttattttatttatggaccatcccaaccctccagtcgtccactccgctttg
cttgctcttcgatacttggcagaatgccgtgcaaacagagaaaagatgaaaggagaactg
ggtatgatgttgagcttacaaaatgttatacagaaaactacaactccaggagaaacaaaa
cttctggcctctgaaatctatgacattcttcagtcctccaatatggcagatggtgatagt
tttaatgagatgaattcacgtcgaaggaaagctcaattttttctgggaactacaaacaaa
cgtgccaaaacagtggttttgcatatagatggccttgatgatacgtctcggagaaatcta
tgtgaagaggctttgttaaaaattaaaggtgttattagctttacttttcaaatggctgtt
caaaggtgtgtggtgcgaatccgttcagatttgaaagctgaggctttggcatcagcaata
gcatcaaccaaggttatgaaagctcagcaagttgtgaaaagtgaaagtggagaagagatg
ttggtcccattccaagatactcctgtggaagttgaacagaacacagagctacctgactac
ctgcctgaggatgagagtcccacaaaggaacaggacaaagcggtgtcccgggtcggctca
cacccagaaggtggagctagctggcttagcacagctgcaaactttttatccagatcattt
tattggtga

DBGET integrated database retrieval system