KEGG   Homo sapiens (human): 55159
Entry
55159             CDS       T01001                                 
Symbol
RFWD3, FANCW, RNF201
Name
(RefSeq) ring finger and WD repeat domain 3
  KO
K15691  E3 ubiquitin-protein ligase RFWD3 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Disease
H00238  Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    55159 (RFWD3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     55159 (RFWD3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    55159 (RFWD3)
SSDB
Motif
Pfam: zf-RING_2 zf-C3HC4 zf-RING_UBOX zf-C3HC4_2 zf-C3HC4_3 zf-RING_11 zf-rbx1 zf-RING_5 Prok-RING_4 WD40_2 Rtf2 zf-C3HC4_4 Nairovirus_M zf-ANAPC11 zf-Nse NBCH_WD40
Other DBs
NCBI-GeneID: 55159
NCBI-ProteinID: NP_060594
OMIM: 614151
HGNC: 25539
Ensembl: ENSG00000168411
Pharos: Q6PCD5(Tbio)
UniProt: Q6PCD5
Structure
Position
16:complement(74621399..74666877)
AA seq 774 aa
MAHEAMEYDVQVQLNHAEQQPAPAGMASSQGGPALLQPVPADVVSSQGVPSILQPAPAEV
ISSQATPPLLQPAPQLSVDLTEVEVLGEDTVENINPRTSEQHRQGSDGNHTIPASSLHSM
TNFISGLQRLHGMLEFLRPSSSNHSVGPMRTRRRVSASRRARAGGSQRTDSARLRAPLDA
YFQVSRTQPDLPATTYDSETRNPVSEELQVSSSSDSDSDSSAEYGGVVDQAEESGAVILE
EQLAGVSAEQEVTCIDGGKTLPKQPSPQKSEPLLPSASMDEEEGDTCTICLEQWTNAGDH
RLSALRCGHLFGYRCISTWLKGQVRKCPQCNKKARHSDIVVLYARTLRALDTSEQERMKS
SLLKEQMLRKQAELESAQCRLQLQVLTDKCTRLQRRVQDLQKLTSHQSQNLQQPRGSQAW
VLSCSPSSQGQHKHKYHFQKTFTVSQAGNCRIMAYCDALSCLVISQPSPQASFLPGFGVK
MLSTANMKSSQYIPMHGKQIRGLAFSSYLRGLLLSASLDNTIKLTSLETNTVVQTYNAGR
PVWSCCWCLDEANYIYAGLANGSILVYDVRNTSSHVQELVAQKARCPLVSLSYMPRAASA
AFPYGGVLAGTLEDASFWEQKMDFSHWPHVLPLEPGGCIDFQTENSSRHCLVTYRPDKNH
TTIRSVLMEMSYRLDDTGNPICSCQPVHTFFGGPTCKLLTKNAIFQSPENDGNILVCTGD
EAANSALLWDAASGSLLQDLQTDQPVLDICPFEVNRNSYLATLTEKMVHIYKWE
NT seq 2325 nt   +upstreamnt  +downstreamnt
atggctcatgaagcaatggaatatgatgttcaggtgcagttaaatcatgccgaacaacag
ccagctcctgctggcatggccagcagccaagggggaccagccctcctccagcctgttcct
gctgatgtggtcagcagccagggggtaccatccatcctccagccagctcctgctgaggtg
atcagcagccaagcgacaccacccctgctccagcctgctccgcaactgtctgttgacctg
acagaagtggaggtcttgggagaagacactgtggagaacatcaatccaagaacttcagaa
caacataggcagggatctgatggtaatcacaccatcccagcatcttcgttgcattcaatg
accaacttcatcagcggactgcagagacttcatggcatgctggaattcctgagaccttca
tcttcaaaccacagtgtagggccaatgagaacaagaaggagggtatctgcttcacggagg
gcaagagccggagggtctcagaggacagacagtgccaggttgagagcaccattggatgct
tactttcaggtgagcaggacccagcctgacttgccagctaccacttatgattcagagact
aggaatcctgtatctgaagagttgcaggtgtctagtagttctgattctgacagtgacagc
tctgcagagtatggaggggttgttgaccaggcagaggaatctggagctgtcattttagaa
gagcaactagcaggtgtctcagcagagcaagaagttacatgtatcgatggaggcaagacc
ctccccaaacagccatctccccagaagtctgagcctctgctaccttctgcttctatggat
gaggaagaaggggacacttgtacaatatgtctggaacagtggaccaatgctggggaccac
cggctctcagcattacgctgtgggcatctctttgggtataggtgcatttccacgtggctt
aaaggacaagtacgaaaatgtccccagtgcaacaagaaagccaggcacagtgacattgtc
gtcctttatgcccgaaccctgagagctttggacactagtgaacaggagcgcatgaaaagt
tccctactgaaggaacagatgctaaggaaacaggccgagttagaatcagcacagtgccga
ctccaactgcaggtcctcactgataagtgcactaggcttcaaaggcgtgttcaggacttg
caaaaacttacgtcacatcaaagtcagaatttacagcaacccaggggctcccaagcatgg
gtcctgagctgctcaccctccagccagggccagcacaagcacaagtaccacttccaaaag
accttcacagtatctcaggcaggaaactgccggatcatggcatactgtgatgctctgagc
tgcctggtgatatcacagccttctcctcaggcctcttttcttccaggctttggtgttaag
atgttgagtactgccaacatgaagagcagtcagtacattccgatgcatggcaaacagatc
cgtggactggcgtttagcagttacctcagaggcttgctactctctgcttccctagacaac
actattaaactgaccagcctggagacaaataccgtggtccagacttataatgctggacgt
cctgtctggagctgttgctggtgtcttgatgaggctaactacatctatgctggactggcc
aatggttcaattctggtatatgacgtgcgaaacacgagcagtcatgtgcaggagttagta
gctcagaaagccagatgcccactggtctccctgtcatacatgcccagagctgcctcagct
gcatttccatatggtggggtgctggctggaaccttggaggatgcttcattctgggaacag
aaaatggacttttctcattggcctcatgtgctgcccttggagccagggggctgcatagac
tttcagacagagaacagctcccggcactgtcttgtgacctacaggcctgataaaaatcac
accaccatacgaagtgtgctgatggaaatgtcctaccgactggatgacactggaaatcca
atctgctcctgccagcctgtacatacattttttggaggacctacttgcaaactattgacc
aaaaatgccattttccaaagcccagagaatgatggcaacatcctggtgtgtactggggat
gaagcagcaaattctgccctgctgtgggatgctgccagtggctcgttgctccaggaccta
cagaccgatcagcctgtgttggacatctgcccatttgaggtgaaccgtaacagctacttg
gctaccttaacagagaagatggtccacatctataagtgggagtga

DBGET integrated database retrieval system