KEGG   Homo sapiens (human): 5516Help
Entry
5516              CDS       T01001                                 

Gene name
PPP2CB, PP2Abeta, PP2CB
Definition
(RefSeq) protein phosphatase 2 catalytic subunit beta
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05142  Chagas disease (American trypanosomiasis)
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Drug target
Fostriecin sodium: D04262
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5516 (PPP2CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5516 (PPP2CB)
   04390 Hippo signaling pathway
    5516 (PPP2CB)
   04071 Sphingolipid signaling pathway
    5516 (PPP2CB)
   04151 PI3K-Akt signaling pathway
    5516 (PPP2CB)
   04152 AMPK signaling pathway
    5516 (PPP2CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5516 (PPP2CB)
   04136 Autophagy - other
    5516 (PPP2CB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    5516 (PPP2CB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5516 (PPP2CB)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5516 (PPP2CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    5516 (PPP2CB)
   04730 Long-term depression
    5516 (PPP2CB)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05160 Hepatitis C
    5516 (PPP2CB)
   05165 Human papillomavirus infection
    5516 (PPP2CB)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    5516 (PPP2CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5516 (PPP2CB)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5516 (PPP2CB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5516 (PPP2CB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5516 (PPP2CB)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     5516 (PPP2CB)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5516 (PPP2CB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5516 (PPP2CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N DUF5378
Motif
Other DBs
NCBI-GeneID: 5516
NCBI-ProteinID: NP_001009552
OMIM: 176916
HGNC: 9300
Ensembl: ENSG00000104695
Vega: OTTHUMG00000163949
Pharos: P62714(Tbio)
UniProt: P62714 A0A140VJS0
Position
8p12
AA seq 309 aa AA seqDB search
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaaggcgttcaccaaggagctggaccagtgggtcgagcagctgaacgagtgt
aagcagctgaacgagaaccaagtgcggacgctgtgcgagaaggcaaaggaaattttaaca
aaagaatcaaatgtgcaagaggttcgttgccctgttactgtctgtggagatgtgcatggt
caatttcatgatcttatggaactctttagaattggtggaaaatcaccggatacaaactac
ttattcatgggtgactatgtagacagaggatattattcagtggagactgtgactcttctt
gtagcattaaaggtgcgttatccagaacgcattacaatattgagaggaaatcacgaaagc
cgacaaattacccaagtatatggcttttatgatgaatgtctgcgaaagtatgggaatgcc
aacgtttggaaatattttacagatctctttgattatcttccacttacagctttagtagat
ggacagatattctgcctccatggtggcctctctccatccatagacacactggatcatata
agagccctggatcgtttacaggaagttccacatgagggcccaatgtgtgatctgttatgg
tcagatccagatgatcgtggtggatggggtatttcaccacgtggtgctggctacacattt
ggacaagacatttctgaaacctttaaccatgccaatggtctcacactggtttctcgtgcc
caccagcttgtaatggagggatacaattggtgtcatgatcggaatgtggttaccattttc
agtgcacccaattactgttatcgttgtgggaaccaggctgctatcatggaattagatgac
actttaaaatattccttccttcaatttgacccagcgcctcgtcgtggtgagcctcatgtt
acacggcgcaccccagactacttcctataa

DBGET integrated database retrieval system