KEGG   Homo sapiens (human): 55165
Entry
55165             CDS       T01001                                 
Symbol
CEP55, C10orf3, CT111, MARCH, URCC6
Name
(RefSeq) centrosomal protein 55
  KO
K16456  centrosomal protein CEP55
Organism
hsa  Homo sapiens (human)
Disease
H01937  Multinucleated neurons, anhydramnios, renal dysplasia, cerebellar hypoplasia, and hydranencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55165 (CEP55)
   03036 Chromosome and associated proteins [BR:hsa03036]
    55165 (CEP55)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Midbophagy associated proteins
    55165 (CEP55)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    55165 (CEP55)
SSDB
Motif
Pfam: EABR zf-C2H2_3 Cep57_CLD_2 zf-TFIIB DUF6212 CENP-F_leu_zip
Other DBs
NCBI-GeneID: 55165
NCBI-ProteinID: NP_001120654
OMIM: 610000
HGNC: 1161
Ensembl: ENSG00000138180
Pharos: Q53EZ4(Tbio)
UniProt: Q53EZ4
Structure
Position
10:93496612..93529092
AA seq 464 aa
MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGKLTDKERHRLL
EKIRVLEAEKEKNAYQLTEKDKEIQRLRDQLKARYSTTTLLEQLEETTREGERREQVLKA
LSEEKDVLKQQLSAATSRIAELESKTNTLRLSQTVAPNCFNSSINNIHEMEIQLKDALEK
NQQWLVYDQQREVYVKGLLAKIFELEKKTETAAHSLPQQTKKPESEGYLQEEKQKCYNDL
LASAKKDLEVERQTITQLSFELSEFRRKYEETQKEVHNLNQLLYSQRRADVQHLEDDRHK
TEKIQKLREENDIARGKLEEEKKRSEELLSQVQFLYTSLLKQQEEQTRVALLEQQMQACT
LDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPLVTFQGETENRE
KVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCSK
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgtcttccagaagtaccaaagatttaattaaaagtaagtggggatcgaagcctagtaac
tccaaatccgaaactacattagaaaaattaaagggagaaattgcacacttaaagacatca
gtggatgaaatcacaagtgggaaaggaaagctgactgataaagagagacacagacttttg
gagaaaattcgagtccttgaggctgagaaggagaagaatgcttatcaactcacagagaag
gacaaagaaatacagcgactgagagaccaactgaaggccagatatagtactaccacattg
cttgaacagctggaagagacaacgagagaaggagaaaggagggagcaggtgttgaaagcc
ttatctgaagagaaagacgtattgaaacaacagttgtctgctgcaacctcacgaattgct
gaacttgaaagcaaaaccaatacactccgtttatcacagactgtggctccaaactgcttc
aactcatcaataaataatattcatgaaatggaaatacagctgaaagatgctctggagaaa
aatcagcagtggctcgtgtatgatcagcagcgggaagtctatgtaaaaggacttttagca
aagatctttgagttggaaaagaaaacggaaacagctgctcattcactcccacagcagaca
aaaaagcctgaatcagaaggttatcttcaagaagagaagcagaaatgttacaacgatctc
ttggcaagtgcaaaaaaagatcttgaggttgaacgacaaaccataactcagctgagtttt
gaactgagtgaatttcgaagaaaatatgaagaaacccaaaaagaagttcacaatttaaat
cagctgttgtattcacaaagaagggcagatgtgcaacatctggaagatgataggcataaa
acagagaagatacaaaaactcagggaagagaatgatattgctaggggaaaacttgaagaa
gagaagaagagatccgaagagctcttatctcaggtccagtttctttacacatctctgcta
aagcagcaagaagaacaaacaagggtagctctgttggaacaacagatgcaggcatgtact
ttagactttgaaaatgaaaaactcgaccgtcaacatgtgcagcatcaattgcatgtaatt
cttaaggagctccgaaaagcaagaaatcaaataacacagttggaatccttgaaacagctt
catgagtttgccatcacagagccattagtcactttccaaggagagactgaaaacagagaa
aaagttgccgcctcaccaaaaagtcccactgctgcactcaatgaaagcctggtggaatgt
cccaagtgcaatatacagtatccagccactgagcatcgcgatctgcttgtccatgtggaa
tactgttcaaagtag

DBGET integrated database retrieval system