KEGG   Homo sapiens (human): 55166
Entry
55166             CDS       T01001                                 

Gene name
CENPQ, C6orf139, CENP-Q
Definition
(RefSeq) centromere protein Q
  KO
K11509  centromere protein Q
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    55166 (CENPQ)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     55166 (CENPQ)
SSDB
Motif
Pfam: CENP-Q DUF5798
Other DBs
NCBI-GeneID: 55166
NCBI-ProteinID: NP_060602
OMIM: 611506
HGNC: 21347
Ensembl: ENSG00000031691
Vega: OTTHUMG00000014815
Pharos: Q7L2Z9(Tdark)
UniProt: Q7L2Z9
Position
6p12.3
AA seq 268 aa
MSGKANASKKNAQQLKRNPKRKKDNEEVVLSENKVRNTVKKNKNHLKDLSSEGQTKHTNL
KHGKTAASKRKTWQPLSKSTRDHLQTMMESVIMTILSNSIKEKEEIQYHLNFLKKRLLQQ
CETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEIDKMVETTELMTGNIQSLK
NKIQILASEVEEEEERVKQMHQINSSGVLSLPELSQKTLKAPTLQKEILALIPNQNALLK
DLDILHNSSQMKSMSTFIEEAYKKLDAS
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtctggtaaagcaaatgcttccaagaaaaacgctcaacagttaaaaagaaatccaaag
agaaaaaaggataatgaggaagttgtgttgtcagagaataaggttagaaacacagtgaaa
aaaaataaaaatcatctgaaagatctgtcttctgaaggacaaacaaagcacactaaccta
aaacacggaaagacagcagccagcaagagaaaaacctggcaacctctgtcaaagagtacc
agagaccatttgcaaactatgatggaatcagtaataatgacaattttgagtaacagtatt
aaagaaaaagaagaaatacaataccatctcaacttcctgaagaaaagattgctacaacag
tgtgaaactctgaaagtccctcccaaaaagatggaagatttaactaatgtatcaagtcta
ctgaatatggaaagggcacgagacaaagctaatgaagaaggtctggcattactacaggaa
gaaatagataaaatggtagagaccacagagttaatgactgggaatattcagagcctaaag
aacaaaattcagattctggcaagtgaggtggaagaagaagaggagagagtaaaacagatg
catcaaataaatagtagtggagtactctctcttccggaactttctcagaaaactctcaaa
gcacccacacttcagaaagaaattttggcgctaattccaaaccagaatgctcttctaaag
gacttggatattcttcataattcatcacagatgaagagcatgtcaaccttcattgaagaa
gcctataagaaactggatgcatcttaa

DBGET integrated database retrieval system