KEGG   Homo sapiens (human): 55174
Entry
55174             CDS       T01001                                 

Gene name
INTS10, C8orf35, INT10
Definition
(RefSeq) integrator complex subunit 10
  KO
K13147  integrator complex subunit 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    55174 (INTS10)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   Integrator complex
    55174 (INTS10)
SSDB
Other DBs
NCBI-GeneID: 55174
NCBI-ProteinID: NP_060612
OMIM: 611353
HGNC: 25548
Ensembl: ENSG00000104613
Vega: OTTHUMG00000131065
Pharos: Q9NVR2(Tdark)
UniProt: Q9NVR2
Position
8p21.3
AA seq 710 aa
MSAQGDCEFLVQRARELVPQDLWAAKAWLITARSLYPADFNIQYEMYTIERNAERTATAG
RLLYDMFVNFPDQPVVWREISIITSALRNDSQDKQTQFLRSLFETLPGRVQCEMLLKVTE
QCFNTLERSEMLLLLLRRFPETVVQHGVGLGEALLEAETIEEQESPVNCFRKLFVCDVLP
LIINNHDVRLPANLLYKYLNKAAEFYINYVTRSTQIENQHQGAQDTSDLMSPSKRSSQKY
IIEGLTEKSSQIVDPWERLFKILNVVGMRCEWQMDKGRRSYGDILHRMKDLCRYMNNFDS
EAHAKYKNQVVYSTMLVFFKNAFQYVNSIQPSLFQGPNAPSQVPLVLLEDVSNVYGDVEI
DRNKHIHKKRKLAEGREKTMSSDDEDCSAKGRNRHIVVNKAELANSTEVLESFKLARESW
ELLYSLEFLDKEFTRICLAWKTDTWLWLRIFLTDMIIYQGQYKKAIASLHHLAALQGSIS
QPQITGQGTLEHQRALIQLATCHFALGEYRMTCEKVLDLMCYMVLPIQDGGKSQEEPSKV
KPKFRKGSDLKLLPCTSKAIMPYCLHLMLACFKLRAFTDNRDDMALGHVIVLLQQEWPRG
ENLFLKAVNKICQQGNFQYENFFNYVTNIDMLEEFAYLRTQEGGKIHLELLPNQGMLIKH
HTVTRGITKGVKEDFRLAMERQVSRCGENLMVVLHRFCINEKILLLQTLT
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgtctgcccagggggactgcgagttcctggtgcagcgagcccgggagttggtgccgcaa
gacctgtgggcagccaaggcgtggctgatcacggcccgcagcctctacccggcagacttt
aacatccagtatgagatgtacaccatcgagcggaatgcagagcggaccgccaccgccggg
aggctgctgtacgacatgtttgtgaatttcccagaccagccggtggtgtggagagaaatc
agcattattacatcagcattaaggaacgattcacaggacaaacaaacccaatttttaaga
agtttatttgaaactcttcctggtcgggtccagtgtgaaatgttactaaaggtcacggaa
caatgcttcaacacgttagaacgatcagaaatgttgcttctacttttgaggcgcttccct
gaaacggtggtgcagcatggggttggccttggggaggcactattagaggctgaaactatt
gaagaacaagaatctccagtgaactgctttagaaaattatttgtttgtgatgtccttcct
ctaataattaacaaccatgatgttcgattacctgccaatttattgtataagtacttgaac
aaagcagctgaattttatatcaattatgtcactaggtctactcaaatagaaaatcagcat
caaggcgcccaggatacatctgatttaatgtcacctagcaaacgtagctctcagaagtac
ataatagaagggctgacggaaaaatcatcccagatcgtggacccttgggagaggttgttt
aagattttgaatgttgttggaatgagatgtgaatggcagatggataaaggaagacgaagc
tatggagatattttgcatagaatgaaggatctctgcagatacatgaacaactttgatagt
gaagcacatgcaaaatataaaaaccaagtggtgtattccaccatgctggtcttctttaag
aatgcattccagtatgtcaacagcatacagccatctctcttccaaggtcctaatgccccg
agccaagttccactggttcttcttgaagatgtatcgaatgtgtatggtgatgtagaaatt
gatcgtaataaacacatccataaaaagaggaaactagctgaaggaagagaaaaaaccatg
agttcagacgatgaagactgttcggcgaaaggaagaaatcgtcacattgtagtcaataaa
gccgaacttgctaactccactgaagtgttagaaagctttaaattggccagggagagctgg
gagttgctctattccctagaattccttgacaaagaatttacaaggatttgcttggcctgg
aagacggatacttggctttggttaagaatcttcctcactgatatgatcatctatcagggt
caatataaaaaggcgatagccagcctgcatcacttagcagctctccagggatccatttct
cagccacagatcacagggcaggggaccctggagcatcagagggcgctcatccagctggcg
acgtgccactttgcgctaggggagtacagaatgacatgtgaaaaagtccttgatttgatg
tgctacatggtactccccattcaagatggaggcaaatcccaggaggaaccctcgaaagta
aagcccaaatttagaaaaggttcggatctgaagctcctgccttgtaccagcaaggctatc
atgccatactgcctccatttaatgttagcctgttttaagcttagagctttcacagacaac
agagacgacatggcattggggcatgtgattgtgttgcttcagcaagagtggccacggggc
gagaatcttttcctgaaagctgtcaataaaatttgccaacaaggaaatttccaatatgag
aattttttcaattacgttacaaatattgatatgctggaggaatttgcctacttgagaact
caggaaggtgggaaaattcatctggaattactacccaatcaaggaatgctgatcaagcac
cacactgtaactcgaggcatcaccaaaggcgtgaaggaggactttcgcctggccatggag
cgccaggtctcccgctgtggagagaatctgatggtggttctgcacaggttctgcattaat
gagaagatcttgctccttcagactctgacctga

DBGET integrated database retrieval system