KEGG   Homo sapiens (human): 55177Help
Entry
55177             CDS       T01001                                 

Gene name
RMDN3, FAM82A2, FAM82C, RMD-3, RMD3, ptpip51
Definition
(RefSeq) regulator of microtubule dynamics 3
  KO
K23293  regulator of microtubule dynamics protein 3
Organism
hsa  Homo sapiens (human)
Brite
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   ER-mitochondria tethering complex
    55177 (RMDN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_11
Motif
Other DBs
NCBI-GeneID: 55177
NCBI-ProteinID: NP_001291731
OMIM: 611873
HGNC: 25550
Ensembl: ENSG00000137824
Vega: OTTHUMG00000130066
Pharos: Q96TC7(Tbio)
UniProt: Q96TC7 A0A024R9P6
Position
15q15.1
AA seq 470 aa AA seqDB search
MSRLGALGGARAGLGLLLGTAAGLGFLCLLYSQRWKRTQRHGRSQSLPNSLDYTQTSDPG
RHVMLLRAVPGGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAG
EIVGEVRCHMEENQRVARRRRFPFVRERSDSTGSSSVYFTASSGATFTDAESEGGYTTAN
AESDNERDSDKESEDGEDEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLP
LLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSY
ALDGKEEAEAALEKGDESADCHLWYAVLCGQLAEHESIQRRIQSGFSFKEHVDKAIALQP
ENPMAHFLLGRWCYQVSHLSWLEKKTATALLESPLSATVEDALQSFLKAEELQPGFSKAG
RVYISKCYRELGKNSEARWWMKLALELPDVTKEDLAIQKDLEELEVILRD
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtctagactgggagccctgggtggtgcccgtgccgggctgggactgttgctgggtacc
gccgccggccttggattcctgtgcctcctttacagccagcgatggaaacggacccagcgt
catggccgcagccagagcctgcccaactccctggactatacgcagacttcagatcccgga
cgccacgtgatgctcctgcgggctgtcccaggtggggctggagatgcctcagtgctgccc
agccttccacgggaaggacaggagaaggtgctggaccgcctggactttgtgctgaccagc
cttgtggcgctgcggcgggaggtggaggagctgagaagcagcctgcgagggcttgcgggg
gagattgttggggaggtccgatgccacatggaagagaaccagagagtggctcggcggcga
aggtttccgtttgtccgggagaggagtgactccactggctccagctctgtctacttcacg
gcctcctcgggagccacgttcacagatgctgagagtgaagggggttacacaacagccaat
gcggagtctgacaatgagcgggactctgacaaagaaagtgaggacggggaagatgaagtg
agctgtgagactgtgaagatggggagaaaggattctcttgacttggaggaagaggcagct
tcaggtgcctccagtgccctggaggctggaggttcctcaggcttggaggatgtgctgccc
ctcctgcagcaggccgacgagctgcacaggggtgatgagcaaggcaagcgggagggcttc
cagctgctgctcaacaacaagctggtgtatggaagccggcaggactttctctggcgcctg
gcccgagcctacagtgacatgtgtgagctcactgaggaggtgagcgagaagaagtcatat
gccctagatggaaaagaagaagcagaggctgctctggagaagggggatgagagtgctgac
tgtcacctgtggtatgcggtgctttgtggtcagctggctgagcatgagagcatccagagg
cgcatccagagtggctttagcttcaaggagcatgtggacaaagccattgctctccagcca
gaaaaccccatggctcactttcttcttggcaggtggtgctatcaggtctctcacctgagc
tggctagaaaaaaaaactgctacagccttgcttgaaagccctctcagtgccactgtggaa
gatgccctccagagcttcctaaaggctgaagaactacagccaggattttccaaagcagga
agggtatatatttccaagtgctacagagaactagggaaaaactctgaagctagatggtgg
atgaagttggccctggagctgccagatgtcacgaaggaggatttggctatccagaaggac
ctggaagaactggaagtcattttacgagactaa

DBGET integrated database retrieval system