KEGG   Homo sapiens (human): 55178
Entry
55178             CDS       T01001                                 

Gene name
MRM3, RMTL1, RNMTL1
Definition
(RefSeq) mitochondrial rRNA methyltransferase 3
  KO
K20095  16S rRNA (guanosine(1370)-2'-O)-methyltransferase [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    55178 (MRM3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     55178 (MRM3)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   55178 (MRM3)
SSDB
Motif
Pfam: SpoU_methylase SpoU_sub_bind DUF3391
Other DBs
NCBI-GeneID: 55178
NCBI-ProteinID: NP_060616
OMIM: 612600
HGNC: 18485
Ensembl: ENSG00000171861
Vega: OTTHUMG00000090285
Pharos: Q9HC36(Tdark)
UniProt: Q9HC36
Position
17p13.3
AA seq 420 aa
MAALVRPARFVVRPLLQVVQAWDLDARRWVRALRRSPVKVVFPSGEVVEQKRAPGKQPRK
APSEASAQEQREKQPLEESASRAPSTWEESGLRYDKAYPGDRRLSSVMTIVKSRPFREKQ
GKILLEGRRLISDALKAGAVPKMFFFSRLEYLKELPVDKLKGVSLIKVKFEDIKDWSDLV
TPQGIMGIFAKPDHVKMTYPKTQLQHSLPLLLICDNLRDPGNLGTILRSAAGAGCSKVLL
TKGCVDAWEPKVLRAGMGAHFRMPIINNLEWETVPNYLPPDTRVYVADNCGLYAQAEMSN
KASDHGWVCDQRVMKFHKYEEEEDVETGASQDWLPHVEVQSYDSDWTEAPAAVVIGGETY
GVSLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLFEGKRQLRGRAEDLSRDRSYH
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggcggcgctggtgagacccgcgaggtttgtcgtgcgaccgttgctgcaggtggtccag
gcttgggaccttgacgcgaggcgctgggtccgggcgctgcggcggagcccagtgaaagtg
gtgtttccttccggagaggtggtggaacagaagcgcgctcctgggaagcagccccgcaag
gcaccatctgaggccagtgcccaggagcaacgagagaaacaaccgctcgaggagtccgca
tcccgcgctcccagcacctgggaagagtctgggcttcgctacgataaagcttatcccggg
gacaggaggctgagcagtgtaatgacaatagtaaagtccaggccatttcgggaaaaacaa
gggaagatcctgctggaaggtcgcaggctcatttcagacgctctcaaggctggagctgtg
ccaaaaatgttcttctttagccgtctagaatacctaaaggagttgccagtcgataagctg
aaaggtgtcagcctcattaaggtgaaatttgaggatatcaaggattggtccgacctcgta
acgccacaaggaataatggggatttttgccaagcctgaccatgttaagatgacatatcca
aagactcagcttcagcattcactgcctttattattgatttgtgacaatctccgtgaccct
gggaacctggggacaattctgagatctgcagctggggcaggctgcagcaaagtgttactc
accaaaggctgtgtggatgcctgggagcccaaagtgctccgggcgggtatgggcgcacat
ttccggatgcccattatcaataatctggaatgggaaaccgtgcccaattacctgccccct
gacactcgggtctatgtggctgacaactgtggcctttatgcccaggctgagatgtctaat
aaagctagtgaccatggctgggtgtgtgatcaacgagtgatgaagtttcacaagtatgag
gaagaggaagatgtagaaaccggagccagtcaagattggctgcctcatgttgaggttcag
agttacgactcggactggacagaggcgccggcagctgtggtgattggcggggagacctac
ggcgtgagcctggagtccctgcagctggccgagagcactggtggcaagaggctgctgatc
cccgttgtgcctggtgtggacagcctcaactcggccatggcggcaagcatcctgcttttc
gaagggaaaagacagctgcgggggagggcggaggacttgagcagggacaggagttaccac
tga

DBGET integrated database retrieval system