KEGG   Homo sapiens (human): 5518Help
Entry
5518              CDS       T01001                                 

Gene name
PPP2R1A, MRD36, PP2A-Aalpha, PP2AA, PP2AAALPHA, PR65A
Definition
(RefSeq) protein phosphatase 2 scaffold subunit Aalpha
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05142  Chagas disease (American trypanosomiasis)
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Disease
H00773  Autosomal dominant mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5518 (PPP2R1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5518 (PPP2R1A)
   04390 Hippo signaling pathway
    5518 (PPP2R1A)
   04071 Sphingolipid signaling pathway
    5518 (PPP2R1A)
   04151 PI3K-Akt signaling pathway
    5518 (PPP2R1A)
   04152 AMPK signaling pathway
    5518 (PPP2R1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5518 (PPP2R1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5518 (PPP2R1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5518 (PPP2R1A)
  09156 Nervous system
   04728 Dopaminergic synapse
    5518 (PPP2R1A)
   04730 Long-term depression
    5518 (PPP2R1A)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05160 Hepatitis C
    5518 (PPP2R1A)
   05165 Human papillomavirus infection
    5518 (PPP2R1A)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    5518 (PPP2R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5518 (PPP2R1A)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5518 (PPP2R1A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5518 (PPP2R1A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5518 (PPP2R1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N TAF6_C M11L Spore_Cse60
Motif
Other DBs
NCBI-GeneID: 5518
NCBI-ProteinID: NP_055040
OMIM: 605983
HGNC: 9302
Ensembl: ENSG00000105568
Vega: OTTHUMG00000137367
Pharos: P30153(Tbio)
UniProt: P30153 A8K7B7
Structure
PDB: 

Position
19q13.41
AA seq 589 aa AA seqDB search
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgacggcgacgactcgctgtaccccatcgcggtgctcatagacgaactc
cgcaatgaggacgttcagcttcgcctcaacagcatcaagaagctgtccaccatcgccttg
gcccttggggttgaaaggacccgaagtgagcttctgcctttccttacagataccatctat
gatgaagatgaggtcctcctggccctggcagaacagctgggaaccttcactaccctggtg
ggaggcccagagtacgtgcactgcctgctgccaccgctggagtcgctggccacagtggag
gagacagtggtgcgggacaaggcagtggagtccttacgggccatctcacacgagcactcg
ccctctgacctggaggcgcactttgtgccgctagtgaagcggctggcgggcggcgactgg
ttcacctcccgcacctcggcctgcggcctcttctccgtctgctacccccgagtgtccagt
gctgtgaaggcggaacttcgacagtacttccggaacctgtgctcagatgacacccccatg
gtgcggcgggccgcagcctccaagctgggggagtttgccaaggtgctggagctggacaac
gtcaagagtgagatcatccccatgttctccaacctggcctctgacgagcaggactcggtg
cggctgctggcggtggaggcgtgcgtgaacatcgcccagcttctgccccaggaggatctg
gaggccctggtgatgcccactctgcgccaggccgctgaagacaagtcctggcgcgtccgc
tacatggtggctgacaagttcacagagctccagaaagcagtggggcctgagatcaccaag
acagacctggtccctgccttccagaacctgatgaaagactgtgaggccgaggtgagggcc
gcagcctcccacaaggtcaaagagttctgtgaaaacctctcagctgactgtcgggagaat
gtgatcatgtcccagatcttgccctgcatcaaggagctggtgtccgatgccaaccaacat
gtcaagtctgccctggcctcagtcatcatgggtctctctcccatcttgggcaaagacaac
accatcgagcacctcttgcccctcttcctggctcagctgaaggatgagtgccctgaggta
cggctgaacatcatctctaacctggactgtgtgaacgaggtgattggcatccggcagctg
tcccagtccctgctccctgccattgtggagctggctgaggacgccaagtggcgggtgcgg
ctggccatcattgagtacatgcccctcctggctggacagctgggagtggagttctttgat
gagaaacttaactccttgtgcatggcctggcttgtggatcatgtatatgccatccgcgag
gcagccaccagcaacctgaagaagctagtggaaaagtttgggaaggagtgggcccatgcc
acaatcatccccaaggtcttggccatgtccggagaccccaactacctgcaccgcatgact
acgctcttctgcatcaatgtgctgtctgaggtctgtgggcaggacatcaccaccaagcac
atgctacccacggttctgcgcatggctggggacccggttgccaatgtccgcttcaatgtg
gccaagtctctgcagaagatagggcccatcctggacaacagcaccttgcagagtgaagtc
aagcccatcctagagaagctgacccaggaccaggatgtggacgtcaaatactttgcccag
gaggctctgactgttctgtctctcgcctga

DBGET integrated database retrieval system