KEGG   Homo sapiens (human): 55186
Entry
55186             CDS       T01001                                 

Gene name
SLC25A36, PNC2
Definition
(RefSeq) solute carrier family 25 member 36
  KO
K15116  solute carrier family 25, member 33/36
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55186 (SLC25A36)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   55186 (SLC25A36)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 55186
NCBI-ProteinID: NP_001098117
OMIM: 616149
HGNC: 25554
Ensembl: ENSG00000114120
Vega: OTTHUMG00000160260
Pharos: Q96CQ1(Tbio)
UniProt: Q96CQ1 A0A384MEA9
Position
3q23
AA seq 311 aa
MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVV
SPGPLHCLKVILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQV
HMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGM
SASYAGISETVIHFVIYESIKQKLLEYKTASTMENDEESVKEASDFVGMMLAAATSKTCA
TTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSLYRGLTTHLVRQIPNTAIMMA
TYELVVYLLNG
NT seq 936 nt   +upstreamnt  +downstreamnt
atgagccagagggacacgctggtgcatctgtttgccggaggatgtggtggtacagtggga
gctattctgacatgtccactggaagttgtaaaaacacgactgcagtcatcttctgtgacg
ctttatatttctgaagttcagctgaacaccatggctggagccagtgtcaaccgagtagtg
tctcccggacctcttcattgcctaaaggtgatcttggaaaaagaagggcctcgttccttg
tttagaggactaggccccaatttagtgggggtagccccttccagagcaatatactttgct
gcttattcaaactgcaaggaaaagttgaatgatgtatttgatcctgattctacccaagta
catatgatttcagctgcaatggcaggttttactgcaatcacagcaaccaaccccatttgg
cttataaagactcggttacagcttgatgcaaggaaccgcggggaaaggcgaatgggtgct
tttgaatgtgttcgtaaagtgtatcagacagatggactaaaaggattttataggggcatg
tctgcttcatatgctggtatatcagagactgttatccattttgttatttatgaaagtata
aaacaaaaactactggaatataagactgcttctacaatggaaaatgatgaagagtctgtg
aaagaagcatcagattttgtgggaatgatgctagctgctgccacctcaaaaacttgtgcc
acaactatagcatatccacatgaagttgtaagaacaagactacgtgaagagggaacaaaa
tacagatctttttttcagactctatctttgcttgttcaagaagaaggttatgggtctctt
tatcgtggtctgacaactcatctagtgagacagattccaaacacagccattatgatggcc
acctatgaattggtggtttacctactcaatggatag

DBGET integrated database retrieval system