KEGG   Homo sapiens (human): 5519Help
Entry
5519              CDS       T01001                                 

Gene name
PPP2R1B, PP2A-Abeta, PR65B
Definition
(RefSeq) protein phosphatase 2 scaffold subunit Abeta
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05142  Chagas disease (American trypanosomiasis)
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5519 (PPP2R1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5519 (PPP2R1B)
   04390 Hippo signaling pathway
    5519 (PPP2R1B)
   04071 Sphingolipid signaling pathway
    5519 (PPP2R1B)
   04151 PI3K-Akt signaling pathway
    5519 (PPP2R1B)
   04152 AMPK signaling pathway
    5519 (PPP2R1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5519 (PPP2R1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5519 (PPP2R1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5519 (PPP2R1B)
  09156 Nervous system
   04728 Dopaminergic synapse
    5519 (PPP2R1B)
   04730 Long-term depression
    5519 (PPP2R1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5519 (PPP2R1B)
   05165 Human papillomavirus infection
    5519 (PPP2R1B)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    5519 (PPP2R1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5519 (PPP2R1B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5519 (PPP2R1B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5519 (PPP2R1B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5519 (PPP2R1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N M11L CLASP_N Cas_Csm6
Motif
Other DBs
NCBI-GeneID: 5519
NCBI-ProteinID: NP_002707
OMIM: 603113
HGNC: 9303
Ensembl: ENSG00000137713
Vega: OTTHUMG00000166741
Pharos: P30154(Tbio)
UniProt: P30154
Position
11q23.1
AA seq 601 aa AA seqDB search
MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTR
SELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKA
VESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQ
QFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEAC
VSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQ
NLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASV
IMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMK
LVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKM
AGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLAL
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcatcagagctcgggaccggcccaggagcagcgggtggagatggagatgat
tcgctatacccgatcgcggttttaatcgacgagctccgcaatgaagacgtgcagctccga
ctcaacagtattaagaagttatcaacaattgccctagcacttggagtagaaaggacccga
agtgaattgttgccatttcttacagatacaatttatgatgaagatgaggtactattagct
cttgctgagcagctgggaaatttcactggcctagtgggaggtcctgactttgcccactgt
ctgctgcctcctttggaaaatctggcaactgtggaagagactgttgttcgtgacaaggct
gtggagtccctgagacagatctcccaggagcatactcctgttgctctggaagcttatttt
gtacctctggtgaaacgcttagcaagtggggattggttcacctctcgcacatctgcatgt
ggtttgttcagcgtttgctatcccagggcatcaaatgctgttaaagcagaaatcagacag
caattccgttccttgtgctcagatgacacaccaatggtacgacgtgctgctgcttccaaa
ttgggtgaatttgcaaaagttttggaattagacagtgtgaaaagtgaaattgttccactg
ttcactagtctagcttcagatgaacaggattcagtgcgcctccttgctgtggaagcttgt
gtcagtattgcccagttattgtctcaggatgaccttgagactttggtgatgcctacactt
cgacaagcagcagaagataaatcttggcgcgttcgctatatggtggctgacagattttca
gagctccagaaagccatgggtcctaaaatcaccctaaatgacctcatccccgcctttcag
aacctacttaaagactgtgaagctgaagtccgggcagctgctgcccacaaagtaaaagaa
cttggtgagaacttgcccattgaagatagagagaccataattatgaatcaaattctgcct
tatataaaggaattagtatccgataccaatcaacatgtcaaatcggctctagcttctgta
attatgggattgtctactattttgggcaaagaaaataccattgaacatcttctacctctt
ttcttagctcagttaaaggatgagtgtcctgacgttcgtttgaatatcatctccaatttg
gattgtgtaaatgaagtgattggaatccgtcagctctctcagtctctccttcctgccata
gtggagctggcagaagatgccaaatggagggtccgcctggccatcattgagtatatgccg
ctgctggcaggccagctgggtgtggaattctttgatgaaaagctgaattctttatgtatg
gcttggctcgtggaccatgtatacgccatccgagaagctgccaccaacaacctcatgaaa
ctagttcagaagtttggtacagagtgggcccaaaatactattgttcccaaagtgttagta
atggcaaatgatcctaattacttgcatagaatgaccactttattctgcattaatgcactg
tctgaggcctgtggtcaggaaataactactaagcaaatgctgcccatcgtattaaaaatg
gcaggagaccaagtagcaaatgttcgcttcaatgtggccaaatctctacaaaagattgga
ccaattctagataccaatgctttacagggagaagtgaagccagtactacagaagttaggt
caagatgaagacatggatgtcaaatactttgcacaggaagctataagtgttcttgcattg
gcataa

DBGET integrated database retrieval system