KEGG   Homo sapiens (human): 55191
Entry
55191             CDS       T01001                                 
Symbol
NADSYN1, VCRL3
Name
(RefSeq) NAD synthetase 1
  KO
K01950  NAD+ synthase (glutamine-hydrolysing) [EC:6.3.5.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00912  NAD biosynthesis, tryptophan => quinolinate => NAD
Network
nt06036  Lysine degradation
  Element
N01723  NAD biosynthesis
Disease
H02087  Vertebral, cardiac, renal, and limb defects syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    55191 (NADSYN1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.1  NAD+ synthase (glutamine-hydrolysing)
     55191 (NADSYN1)
SSDB
Motif
Pfam: CN_hydrolase NAD_synthase
Other DBs
NCBI-GeneID: 55191
NCBI-ProteinID: NP_060631
OMIM: 608285
HGNC: 29832
Ensembl: ENSG00000172890
UniProt: Q6IA69
Position
11:71453203..71501816
AA seq 706 aa
MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKNRGARYRLGPELEICGYGCWDHYYES
DTLLHSFQVLAALVESPVTQDIICDVGMPVMHRNVRYNCRVIFLNRKILLIRPKMALANE
GNYRELRWFTPWSRSRHTEEYFLPRMIQDLTKQETVPFGDAVLVTWDTCIGSEICEELWT
PHSPHIDMGLDGVEIITNASGSHQVLRKANTRVDLVTMVTSKNGGIYLLANQKGCDGDRL
YYDGCAMIAMNGSVFAQGSQFSLDDVEVLTATLDLEDVRSYRAEISSRNLAASRASPYPR
VKVDFALSCHEDLLAPISEPIEWKYHSPEEEISLGPACWLWDFLRRSQQAGFLLPLSGGV
DSAATACLIYSMCCQVCEAVRSGNEEVLADVRTIVNQISYTPQDPRDLCGRILTTCYMAS
KNSSQETCTRARELAQQIGSHHISLNIDPAVKAVMGIFSLVTGKSPLFAAHGGSSRENLA
LQNVQARIRMVLAYLFAQLSLWSRGVHGGLLVLGSANVDESLLGYLTKYDCSSADINPIG
GISKTDLRAFVQFCIQRFQLPALQSILLAPATAELEPLADGQVSQTDEEDMGMTYAELSV
YGKLRKVAKMGPYSMFCKLLGMWRHICTPRQVADKVKRFFSKYSMNRHKMTTLTPAYHAE
NYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDGVD
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgggccggaaggtgaccgtggccacctgcgcactcaaccagtgggccctggacttcgag
ggcaatttgcaaagaattttaaagagtattgaaattgccaaaaacagaggagcaagatac
aggcttggaccagagctggaaatatgcggctacggatgttgggatcattattacgagtcg
gacaccctcttgcactcgtttcaagtcctagcggcccttgtggagtctcccgtcactcag
gacatcatctgcgacgtggggatgcctgtaatgcaccgaaacgtccgctacaactgcaga
gtgatattcctcaacaggaagatcctgctcatcagacccaagatggccttggccaatgaa
ggcaactaccgcgagctgcgctggttcaccccgtggtcgaggagtcggcacacagaggag
tactttctgcctcggatgatacaggacctgacaaagcaggaaaccgtacccttcggagat
gcggtgctggtgacatgggacacctgcattggaagtgagatctgtgaggagctctggaca
ccccacagcccgcacatcgacatgggcctggatggcgtggagatcatcaccaacgcctcg
ggcagccaccaagtgctgcgcaaagccaacaccagggtggatctcgtgactatggtcacc
agcaagaacggtgggatttacttgctggccaaccagaagggttgtgacggggaccgcctg
tactacgacggctgtgccatgattgccatgaacggaagcgtctttgctcaaggatcccag
ttttctctggatgacgtggaagtcctgacggccacgctggatctggaggacgtccggagc
tacagggcggagatttcatctcgaaacctggcggccagcagggcgagcccctaccccaga
gtgaaggtggactttgccctctcgtgccacgaggacttgctggcacccatctctgagccc
atcgagtggaaataccacagccctgaggaggagataagccttggacctgcctgctggctc
tgggattttttaagacgaagtcaacaggcagggtttttgctgcccttgagtggcggggtg
gacagcgcagccaccgcctgcctcatctactccatgtgctgccaggtctgcgaggccgtg
aggagtggaaatgaggaagtgctggctgatgtccgcaccatcgtgaaccagatcagctac
accccccaggatccccgagacctctgtggacgcatactgaccacctgctacatggccagc
aagaactcctcccaggagacgtgcacccgggccagagagttggcccagcagattggaagc
caccacatcagtctcaacatcgatccagccgtgaaggccgtcatgggcatcttcagcctg
gtgacggggaagagccctctgtttgcagctcatggaggaagcagcagggaaaacctggcg
ctgcaaaatgtgcaggctcgaatacggatggtcctcgcctatctgtttgctcagttgagc
ctctggtctcggggtgtccacggtgggctcctcgtgctgggatccgccaacgtggatgag
agtctcctgggctacctgaccaagtacgactgctccagtgcggacatcaaccccataggc
gggatcagcaagacggacctcagggccttcgtccagttctgcatccagcgcttccagctt
cctgccctgcagagcatcctgttggcgccggccaccgcagagctggagcccttggctgat
ggacaggtgtcccagaccgacgaggaagatatggggatgacatatgcggagctctcggtc
tatgggaaactcaggaaggtggccaagatggggccctacagcatgttctgcaaactcctc
ggcatgtggagacacatctgcaccccgagacaggtcgctgacaaagtgaagcggtttttc
tccaagtactccatgaacagacacaagatgaccacgctcacacccgcgtaccacgccgag
aactacagccctgaggacaacaggtttgatctgcgaccatttctgtacaacacaagctgg
ccttggcagtttcggtgcatagaaaatcaggtgctacagctcgagagggcagagccacag
tccctggacggcgtggactga

DBGET integrated database retrieval system