KEGG   Homo sapiens (human): 55193Help
Entry
55193             CDS       T01001                                 

Gene name
PBRM1, BAF180, PB1
Definition
(RefSeq) polybromo 1
  KO
K11757  protein polybromo-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    55193 (PBRM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    55193 (PBRM1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    55193 (PBRM1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     55193 (PBRM1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   PBAF complex
    55193 (PBRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain BAH HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 55193
NCBI-ProteinID: NP_060783
OMIM: 606083
HGNC: 30064
Ensembl: ENSG00000163939
Vega: OTTHUMG00000152663
Pharos: Q86U86(Tchem)
UniProt: Q86U86
Structure
PDB: 

Position
3p21.1
AA seq 1582 aa AA seqDB search
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDY
KDEQGRLLCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVNLLTADFQLLF
NNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPA
YLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNG
SYKSIHAMAKDIDLLAKNAKTYNEPGSQVFKDANSIKKIFYMKKAEIEHHEMAKSSLRMR
TPSNLAAARLTGPSHSKGSLGEERNPTSKYYRNKRAVQGGRLSAITMALQYGSESEEDAA
LAAARYEEGESEAESITSFMDVSNPFYQLYDTVRSCRNNQGQLIAEPFYHLPSKKKYPDY
YQQIKMPISLQQIRTKLKNQEYETLDHLECDLNLMFENAKRYNVPNSAIYKRVLKLQQVM
QAKKKELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGR
RLCDLFMVKPSKKDYPDYYKIILEPMDLKIIEHNIRNDKYAGEEGMIEDMKLMFRNARHY
NEEGSQVYNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQ
KLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQD
IDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQE
LIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVENNRYRRLDLF
QEHMFEVLERARRMNRTDSEIYEDAVELQQFFIKIRDELCKNGEILLSPALSYTTKHLHN
DVEKERKEKLPKEIEEDKLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHV
GDYVYVEPAEANLQPHIVCIERLWEDSAEKEVFKSDYYNKVPVSKILGKCVVMFVKEYFK
LCPENFRDEDVFVCESRYSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRVASVFANAD
KGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVF
IKSHGLVRPRVGRIEKVWVRDGAAYFYGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCP
MTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRFSLSAKVVD
DEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSESTPKSAKGSA
KKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAEYEGMM
GGYPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMV
GTPAPGGSPYGQQVGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHS
EAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALW
RLRDLMLRDTLNIRQAYNLENV
NT seq 4749 nt NT seq  +upstreamnt  +downstreamnt
atgggttccaagagaagaagagctacctccccttccagcagtgtcagcggggactttgat
gatgggcaccattctgtgtcaacaccaggcccaagcaggaaaaggaggagactttccaat
cttccaactgtagatcctattgccgtgtgccatgaactctataataccatccgagactat
aaggatgaacagggcagacttctctgtgagctcttcattagggcaccaaagcgaagaaat
caaccagactattatgaagtggtttctcagcccattgacttgatgaaaatccaacagaaa
ctaaaaatggaagagtatgatgatgttaatttgctgactgctgacttccagcttcttttt
aacaatgcaaagtcctattataagccagattctcctgaatataaagccgcttgcaaactc
tgggatttgtaccttcgaacaagaaatgagtttgttcagaaaggagaagcagatgacgaa
gatgatgatgaagatgggcaagacaatcagggcacagtgactgaaggatcttctccagct
tacttgaaggagatcctggagcagcttcttgaagccatagttgtagctacaaatccatca
ggacgtctcattagcgaactttttcagaaactgccttctaaagtgcaatatccagattat
tatgcaataattaaggagcctatagatctcaagaccattgcccagaggatacagaatgga
agctacaaaagtattcatgcaatggccaaagatatagatctcctcgcaaaaaatgccaaa
acttataatgagcctggctctcaagtattcaaggatgcaaattcaattaaaaaaatattt
tatatgaaaaaggctgaaattgaacatcatgaaatggctaagtcaagtcttcgaatgagg
actccatccaacttggctgcagccagactgacaggtccttcacacagtaaaggcagcctt
ggtgaagagagaaatcccactagcaagtattaccgtaataaaagagcagtacaaggaggt
cgtttatcagcaattacaatggcacttcaatatggctcagaaagtgaagaagatgctgct
ttagctgctgcacgctatgaagagggagagtcagaagcagaaagcatcacttcctttatg
gatgtttcaaatcctttttatcagctttatgacacagttaggagttgtcggaataaccaa
gggcagctaatagctgaacctttttaccatttgccttcaaagaaaaaataccctgattat
taccagcaaattaaaatgcccatatcactacaacagatccgaacaaaactgaagaatcaa
gaatatgaaactttagatcatttggagtgtgatctgaatttaatgtttgaaaatgccaaa
cgctataatgtgcccaattcagccatctacaagcgagttctaaaattgcagcaagttatg
caggcaaagaagaaagagcttgccaggagagacgatatcgaggacggagacagcatgatc
tcttcagccacctctgatactggtagtgccaaaagaaaaagtaaaaagaacataagaaag
cagcgaatgaaaatcttattcaatgttgttcttgaagctcgagagccaggttcaggcaga
agactttgtgacctatttatggttaaaccatccaaaaaggactatcctgattattataaa
atcatcttggagccaatggacttgaaaataattgagcataacatccgcaatgacaaatat
gctggtgaagagggaatgatagaagacatgaagctgatgttccggaatgccaggcactat
aatgaggagggctcccaggtttataatgatgcacatatcctggagaagttactcaaggag
aaaaggaaagagctgggcccactgcctgatgatgatgacatggcttctcccaaactcaag
ctgagtaggaagagtggcatttctcctaaaaaatcaaaatacatgactccaatgcagcag
aaactaaatgaggtctatgaagctgtaaagaactatactgataagaggggtcgccgcctc
agtgccatatttctgaggcttccctctagatctgagttgcctgactactatctgactatt
aaaaagcccatggacatggaaaaaattcgaagtcacatgatggccaacaagtaccaagat
attgactctatggttgaggactttgtcatgatgtttaataatgcctgtacatacaatgag
ccggagtctttgatctacaaagatgctcttgttctacacaaagtcctgcttgaaacacgc
agagacctggagggagatgaggactctcatgtcccaaatgtgactttgctgattcaagag
cttatccacaatctttttgtgtcagtcatgagtcatcaggatgatgagggaagatgctac
agcgattctttagcagaaattcctgctgtggatcccaactttcctaacaaaccacccctt
acatttgacataattaggaagaatgttgaaaataatcgctaccgtcggcttgatttattt
caagagcatatgtttgaagtattggaacgagcaagaaggatgaatcggacagattcagaa
atatatgaagatgcagtagaacttcagcagttttttattaaaattcgtgatgaactctgc
aaaaatggagagattcttctttcaccggcactcagctataccacaaaacatttgcataat
gatgtggagaaagagagaaaggaaaaattgccaaaagaaatagaggaagataaactaaaa
cgagaagaagaaaaaagagaagctgaaaagagtgaagattcctctggtgctgcaggcctc
tcaggcttacatcgcacatacagccaggactgtagctttaaaaacagcatgtaccatgtt
ggagattacgtctatgtggaacctgcagaggccaacctacaaccacatatcgtctgtatt
gaaagactgtgggaggattcagctgaaaaagaagtttttaagagtgactattacaacaaa
gttccagttagtaaaattctaggcaagtgtgtggtcatgtttgtcaaggaatactttaag
ttatgcccagaaaacttccgagatgaggatgtttttgtctgtgaatcacggtattctgcc
aaaaccaaatcttttaagaaaattaaactgtggaccatgcccatcagctcagtcaggttt
gtccctcgggatgtgcctctgcctgtggttcgcgtggcctctgtatttgcaaatgcagat
aaaggtgatgatgagaagaatacagacaactcagaggacagtcgagctgaagacaatttt
aacttggaaaaggaaaaagaagatgtccctgtggaaatgtccaatggtgaaccaggttgc
cactactttgagcagctccattacaatgacatgtggctgaaggttggcgactgtgtcttc
atcaagtcccatggcctggtgcgtcctcgtgtgggcagaattgaaaaagtatgggttcga
gatggagctgcatatttttatggccccatcttcattcacccagaagaaacagagcatgag
cccacaaaaatgttctacaaaaaagaagtatttctgagtaatctggaagaaacctgcccc
atgacatgtattctcggaaagtgtgctgtgttgtcattcaaggacttcctctcctgcagg
ccaactgaaataccagaaaatgacattctgctttgtgagagccgctacaatgagagcgac
aagcagatgaagaaattcaaaggattgaagaggttttcactctctgctaaagtggtagat
gatgaaatttactacttcagaaaaccaattgttcctcagaaggagccatcacctttgctg
gaaaagaagatccagttgctagaagctaaatttgccgagttagaaggtggagatgatgat
attgaagagatgggagaagaagatagtgagtctaccccaaagtctgccaaaggcagtgca
aagaaggaaggctccaaacggaaaatcaacatgagtggctacatcctgttcagcagtgag
atgagggctgtgattaaggcccaacacccagactactctttcggggagctcagccgcctg
gtggggacagaatggagaaatcttgagacagccaagaaagcagaatatgaaggcatgatg
ggtggctatccgccaggccttccacctttgcagggcccagttgatggccttgttagcatg
ggcagcatgcagccacttcaccctggggggcctccaccccaccatcttccgccaggtgtg
cctggcctcccgggcatcccaccaccgggtgtgatgaaccaaggagtggcccctatggta
gggactccagcaccaggtggaagtccatatggacaacaggtgggagttttggggcctcca
gggcagcaggcaccacctccatatcccggcccacatccagctggaccccctgtcatacag
cagccaacaacacccatgtttgtagctcccccaccaaagacccagcggcttcttcactca
gaggcctacctgaaatacattgaaggactcagtgcggagtccaacagcattagcaagtgg
gatcagacactggcagctcgaagacgcgacgtccatttgtcgaaagaacaggagagccgc
ctaccctctcactggctgaaaagcaaaggggcccacaccaccatggcagatgccctctgg
cgccttcgagatttgatgctccgggacaccctcaacattcgccaagcatacaacctagaa
aatgtttaa

DBGET integrated database retrieval system