KEGG   Homo sapiens (human): 55197
Entry
55197             CDS       T01001                                 

Gene name
RPRD1A, HsT3101, P15RS
Definition
(RefSeq) regulation of nuclear pre-mRNA domain containing 1A
  KO
K15559  regulator of Ty1 transposition protein 103
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    55197 (RPRD1A)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     55197 (RPRD1A)
SSDB
Motif
Pfam: CREPT CID CTK3 PhoU VSG_B GlutR_N
Other DBs
NCBI-GeneID: 55197
NCBI-ProteinID: NP_060640
OMIM: 610347
HGNC: 25560
Ensembl: ENSG00000141425
Vega: OTTHUMG00000132591
Pharos: Q96P16(Tbio)
UniProt: Q96P16 A0A024RC37
Structure
PDB: 
4JXT 4NAC

Position
18q12.2
AA seq 312 aa
MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFL
YLANDVIQNSKRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYEND
VLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGD
AAVHQRIASLPVEVQEVSLLDKITDKESGERLSKMVEDACMLLADYNGRLAAEIDDRKQL
TRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELRSRIQSLPDLSRLPNVTGSHM
HLPFAGDIYSED
NT seq 939 nt   +upstreamnt  +downstreamnt
atgtcagccttctctgaggcggcgctggagaagaagctgtcggagttgagcaactcgcag
cagagcgtgcagaccttgtccctgtggctcattcaccaccgtaaacactcgcgtcccatc
gtcaccgtgtgggagcgggagctgcggaaagccaaaccaaacaggaagcttacttttctc
tacctagccaatgatgtcatacagaacagcaagaggaaggggccagagtttacaaaagat
tttgcaccagttatagtggaggcttttaagcatgtttcaagtgaaactgatgaaagttgt
aagaagcaccttggaagagtgttatctatttgggaagaaaggtctgtttatgaaaatgat
gtattagaacaacttaaacaagctctgtatggtgataagaagcctaggaagcgaacttat
gaacagataaaggtggatgaaaatgaaaactgttcctctctgggatctccaagtgaacca
ccacagactctagatctcgttagagcattacaagatctggaaaatgcagcctcaggtgat
gcagcagttcatcagaggatagcttctttacctgttgaagtccaagaagtatctctatta
gataaaataacagataaagaatctggagaaaggctttccaaaatggtagaggatgcgtgt
atgttgctggcagattacaatggcagattggcggcagaaatagatgatagaaagcaactc
actcgaatgttagcagattttcttcgttgtcaaaaggaagcccttgcagagaaagagcat
aaattggaagagtacaagcgcaagctagccagagtttccctggtgcgcaaagaactcagg
tcccggatccagagcctgccagacttatctcgattgcccaatgtcactggcagccacatg
cacctgccctttgcgggagacatctacagtgaagattga

DBGET integrated database retrieval system