KEGG   Homo sapiens (human): 55198Help
Entry
55198             CDS       T01001                                 

Gene name
APPL2, DIP13B
Definition
(RefSeq) adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 2
  KO
K20132  DCC-interacting protein 13-beta
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55198 (APPL2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    55198 (APPL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR_3 PH PID PTB PH_9 PH_17 Pox_RNA_pol_35 DUF3263 PH_2
Motif
Other DBs
NCBI-GeneID: 55198
NCBI-ProteinID: NP_060641
OMIM: 606231
HGNC: 18242
Ensembl: ENSG00000136044
Vega: OTTHUMG00000169853
Pharos: Q8NEU8(Tbio)
UniProt: Q8NEU8
Structure
PDB: 

Position
12q23.3
AA seq 664 aa AA seqDB search
MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQ
LSKQLLAYEKQNFALGKGDEEVISTLHYFSKVVDELNLLHTELAKQLADTMVLPIIQFRE
KDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKKKENEKVKTEVGKEVAAARRKQHLSSLQ
YYCALNALQYRKQMAMMEPMIGFAHGQINFFKKGAEMFSKRMDSFLSSVADMVQSIQVEL
EAEAEKMRVSQQELLSVDESVYTPDSDVAAPQINRNLIQKAGYLNLRNKTGLVTTTWERL
YFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQITTPNGKSGIILQAESR
KENEEWICAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSCPSQNLKNS
EMENENDKIVPKATASLPEAEELIAPGTPIQFDIVLPATEFLDQNRGSRRTNPFGETEDE
SFPEAEDSLLQQMFIVRFLGSMAVKTDSTTEVIYEAMRQVLAARAIHNIFRMTESHLMVT
SQSLRLIDPQTQVSRANFELTSVTQFAAHQENKRLVGFVIRVPESTGEESLSTYIFESNS
EGEKICYAINLGKEIIEVQKDPEALAQLMLSIPLTNDGKYVLLNDQPDDDDGNPNEHRGA
ESEA
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgtggacaagctcctgctagaggaggcgttgcaggacagcccccagactcgc
tctttactgagcgtgtttgaagaagatgctggcaccctcacagactataccaaccagctg
ctccaggcaatgcagcgcgtctatggagcccagaatgagatgtgcctggccacacaacag
ctttctaagcaactgctggcatatgaaaaacagaactttgctcttggcaaaggtgatgaa
gaagtaatttcaacactccactatttttccaaagtggtggatgagcttaatcttctccat
acagagctggctaaacagttggcagacacaatggttctacctatcatacaattccgagaa
aaggatctcacagaagtaagcactttaaaggatctatttggactcgctagcaatgagcat
gacctctcaatggcaaaatacagcaggctgcctaagaaaaaggagaatgagaaggtgaag
accgaagtcggaaaagaggtggccgcggcccggcggaagcagcacctctcctcccttcag
tactactgtgccctcaacgcgctgcagtacagaaagcaaatggccatgatggagcccatg
ataggctttgcccatggacagattaacttttttaagaagggagcagagatgttttccaaa
cgtatggacagctttttatcctccgttgcagacatggttcaaagcattcaggtagaactg
gaagccgaggcggaaaagatgcgggtgtcccagcaagaattactttctgttgatgaatct
gtttacactccagactctgatgtggccgcaccacagatcaacaggaacctcatccagaag
gctggttaccttaatcttagaaacaaaacagggctggtcaccaccacctgggagaggctt
tatttcttcacccaaggcgggaatctcatgtgtcagcccaggggagccgtggctggaggt
ttgatccaggacctggacaactgctcagtgatggccgtggattgcgaagaccggcgctac
tgcttccagatcaccacgcccaatggaaaatcgggaataatcctccaggctgagagcaga
aaggaaaatgaagagtggatatgtgcaataaacaacatctccagacagatctacctgacc
gacaaccctgaggcagtcgcgatcaagttgaatcagaccgctctgcaagcagtgactccc
attacaagttttggaaaaaaacaagaaagctcatgccccagccagaacctgaaaaattca
gagatggaaaatgaaaatgacaagattgttcccaaagcaacagccagtctacctgaagca
gaggagctgatcgcgcctggaacgccgattcaattcgatattgtgcttcctgctacagaa
ttccttgatcagaacagagggagcaggcgtaccaacccttttggtgaaactgaggatgaa
tcatttccagaagcagaagattctcttttgcagcagatgtttatagttcggtttttggga
tcaatggcagttaaaacagacagcactactgaagtgatttatgaagcgatgagacaagta
ttggctgctcgggctattcataacatcttccgcatgacagaatcccatctgatggtcacc
agtcaatctttgaggttgatagatccacagactcaagtatcaagggccaattttgaactt
accagtgtcacacaatttgctgctcatcaagaaaacaagagactggttggttttgtcatc
cgtgttcctgaatccactggagaagaatctctgagtacatacatttttgaaagcaactca
gaaggcgaaaagatatgttatgctattaatttgggaaaagaaattattgaggttcagaag
gatccagaagcactggctcaattaatgctgtccataccactaaccaatgacggaaaatat
gtactgttaaacgatcaaccagatgacgatgatggaaatccaaacgaacatagaggcgca
gaatccgaagcataa

DBGET integrated database retrieval system