KEGG   Homo sapiens (human): 552Help
Entry
552               CDS       T01001                                 

Gene name
AVPR1A, AVPR_V1a, AVPR1, V1aR
Definition
(RefSeq) arginine vasopressin receptor 1A
  KO
K04226  arginine vasopressin receptor 1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
Drug target
Conivaptan (DG00276): D01236 D07748
Felypressin: D04137
Lypressin: D00366
Ornipressin: D07227
Terlipressin (DG00498): D06672 D08571
Vasopressin (Argipressin) (DG00496): D00101 D02983 D09820
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    552 (AVPR1A)
   04072 Phospholipase D signaling pathway
    552 (AVPR1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    552 (AVPR1A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    552 (AVPR1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    552 (AVPR1A)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Vasopressin
    552 (AVPR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF1856 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 552
NCBI-ProteinID: NP_000697
OMIM: 600821
HGNC: 895
Ensembl: ENSG00000166148
Vega: OTTHUMG00000169980
Pharos: P37288(Tclin)
UniProt: P37288 X5D2B0
Structure
PDB: 

Position
12q14.2
AA seq 418 aa AA seqDB search
MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV
TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP
DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV
LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC
YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY
IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV
QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctctccgccggtcccgacgcggggccctcgggcaactccagcccatggtggcct
ctggccaccggcgctggcaacacaagccgggaggccgaagccctcggggagggcaacggc
ccaccgagggacgtgcgcaacgaggagctggccaaactggagatcgccgtgctggcggtg
actttcgcggtggccgtgctgggcaacagcagcgtactgctggctctgcaccggacgccg
cgcaagacgtcccgcatgcacctcttcatccgacacctcagcctggccgacctggccgtg
gcattcttccaggtgctgccgcaaatgtgctgggacatcacctaccgcttccgcggcccc
gactggctgtgccgcgtggtgaagcacctgcaggtgttcggcatgtttgcgtcggcctac
atgctggtagtcatgacagccgaccgctacatcgcggtgtgccacccgctcaagactctg
caacagcccgcgcgccgctcgcgcctcatgatcgcggccgcctgggtgctgagcttcgtg
ctgagcacgccgcagtacttcgtcttctccatgatcgaggtgaacaatgtcaccaaggcc
cgcgactgctgggccaccttcatccagccctggggttctcgtgcctacgtgacctggatg
acgggcggcatctttgtggcgcccgtggtcatcttgggtacctgctacggcttcatctgc
tacaacatctggtgcaacgtccgcgggaagacggcgtcgcgccagagcaagggtgcagag
caagcgggtgtggccttccaaaaggggttcctgctcgcaccctgtgtcagcagcgtgaag
tccatttcccgggccaagatccgcacggtgaagatgacttttgtgatcgtgacggcttac
atcgtctgctgggcgcctttcttcatcatccagatgtggtctgtctgggatcccatgtcc
gtctggaccgaatcggaaaaccctaccatcaccatcactgcattactgggttccttgaat
agctgctgtaatccctggatatacatgttttttagtggccatctccttcaagactgtgtt
caaagcttcccatgctgccaaaacatgaaggaaaaattcaacaaagaagatactgacagt
atgagcagaagacagactttttattctaacaatcgaagcccaacaaacagtacgggtatg
tggaaggactcgcctaaatcttccaagtccatcaaattcattcctgtttcaacttga

DBGET integrated database retrieval system