KEGG   Homo sapiens (human): 5520Help
Entry
5520              CDS       T01001                                 

Gene name
PPP2R2A, B55A, B55ALPHA, PR52A, PR55A, PR55alpha
Definition
(RefSeq) protein phosphatase 2 regulatory subunit Balpha
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04728  Dopaminergic synapse
hsa05142  Chagas disease (American trypanosomiasis)
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5520 (PPP2R2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    5520 (PPP2R2A)
   04071 Sphingolipid signaling pathway
    5520 (PPP2R2A)
   04151 PI3K-Akt signaling pathway
    5520 (PPP2R2A)
   04152 AMPK signaling pathway
    5520 (PPP2R2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5520 (PPP2R2A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5520 (PPP2R2A)
  09156 Nervous system
   04728 Dopaminergic synapse
    5520 (PPP2R2A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5520 (PPP2R2A)
   05165 Human papillomavirus infection
    5520 (PPP2R2A)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    5520 (PPP2R2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5520 (PPP2R2A)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5520 (PPP2R2A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5520 (PPP2R2A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5520 (PPP2R2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 5520
NCBI-ProteinID: NP_002708
OMIM: 604941
HGNC: 9304
Ensembl: ENSG00000221914
Vega: OTTHUMG00000163850
Pharos: P63151(Tchem)
UniProt: P63151 A0A140VJT0
Structure
PDB: 

Position
8p21.2
AA seq 447 aa AA seqDB search
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagctggaggagggaatgatattcagtggtgtttttctcaggtgaaaggagca
gtagatgatgatgtagcagaagcagatataatttctacagtagaatttaatcattctgga
gaattactagcaacaggagataaaggtggtagagttgtcatctttcaacaggagcaggag
aacaaaatccagtctcatagcagaggagaatataatgtttacagcaccttccagagccat
gaaccagagtttgactacttgaaaagtttagaaatagaagaaaagatcaacaaaattagg
tggttaccccagaaaaatgctgctcagtttttattgtctaccaatgataaaacaataaaa
ttatggaaaatcagtgaaagggacaaaagaccagaagggtataacttgaaagaggaggat
ggaaggtatagagatcctactacagttactacactacgagtgccagtctttaggcctatg
gatctaatggttgaggccagtccacgaagaatatttgccaatgctcatacatatcacatc
aactcaatttctattaatagtgattatgaaacatatttatctgcagatgatttgcggatt
aatctttggcatctggaaattacagacaggagttttaacattgtggatatcaagcctgcc
aatatggaagagctaacagaggtgattacagcagcagaatttcatccaaacagctgtaac
acatttgtatacagcagcagtaaaggaactattcggctatgtgacatgagggcatctgcc
ctctgtgatagacattctaaattgtttgaagaacctgaagatcccagtaacaggtcattt
ttttccgaaatcatctcctctatttcggatgtaaaattcagccatagtggtcgatatatg
atgactagagactatttgtcagtcaaaatttgggacttaaatatggaaaacaggcctgtg
gaaacataccaggtgcatgaatacctcagaagtaaactctgttcactgtatgaaaatgac
tgcatatttgacaaatttgaatgttgttggaatggatctgacagtgttgtcatgactgga
tcttacaataatttcttcagaatgtttgacagaaacacaaagcgagacataaccctagaa
gcatcgcgggaaaacaataagcctcgcacagttctgaagcctcgcaaagtctgtgcaagt
ggcaagcgaaagaaagatgaaataagtgttgacagcctagacttcaataagaaaatcctt
cacacagcctggcaccccaaggaaaatatcattgccgtagctactacaaacaatctgtat
atatttcaagacaaagtgaattag

DBGET integrated database retrieval system