KEGG   Homo sapiens (human): 55215Help
Entry
55215             CDS       T01001                                 

Gene name
FANCI, KIAA1794
Definition
(RefSeq) FA complementation group I
  KO
K10895  fanconi anemia group I protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Disease
H00238  Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    55215 (FANCI)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     55215 (FANCI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FANCI_S4 FANCI_HD2 FANCI_S3 FANCI_S1 FANCI_S2 FANCI_HD1 FANCI_S1-cap Vps5 Ribul_P_3_epim DUF3972
Motif
Other DBs
NCBI-GeneID: 55215
NCBI-ProteinID: NP_001106849
OMIM: 611360
HGNC: 25568
Ensembl: ENSG00000140525
Vega: OTTHUMG00000132993
Pharos: Q9NVI1(Tbio)
UniProt: Q9NVI1
Position
15q26.1
AA seq 1328 aa AA seqDB search
MDQKILSLAAEKTADKLQEFLQTLREGDLTNLLQNQAVKGKVAGALLRAIFKGSPCSEEA
GTLRRRKIYTCCIQLVESGDLQKEIASEIIGLLMLEAHHFPGPLLVELANEFISAVREGS
LVNGKSLELLPIILTALATKKENLAYGKGVLSGEECKKQLINTLCSGRWDQQYVIQLTSM
FKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSAL
DKQHNEEQSGDELLDVVTVPSGELRHVEGTIILHIVFAIKLDYELGRELVKHLKVGQQGD
SNNNLSPFSIALLLSVTRIQRFQDQVLDLLKTSVVKSFKDLQLLQGSKFLQNLVPHRSYV
STMILEVVKNSVHSWDHVTQGLVELGFILMDSYGPKKVLDGKTIETSPSLSRMPNQHACK
LGANILLETFKIHEMIRQEILEQVLNRVVTRASSPISHFLDLLSNIVMYAPLVLQSCSSK
VTEAFDYLSFLPLQTVQRLLKAVQPLLKVSMSMRDCLILVLRKAMFANQLDARKSAVAGF
LLLLKNFKVLGSLSSSQCSQSLSVSQVHVDVHSHYNSVANETFCLEIMDSLRRCLSQQAD
VRLMLYEGFYDVLRRNSQLANSVMQTLLSQLKQFYEPKPDLLPPLKLEACILTQGDKISL
QEPLDYLLCCIQHCLAWYKNTVIPLQQGEEEEEEEEAFYEDLDDILESITNRMIKSELED
FELDKSADFSQSTSIGIKNNICAFLVMGVCEVLIEYNFSISSFSKNRFEDILSLFMCYKK
LSDILNEKAGKAKTKMANKTSDSLLSMKFVSSLLTALFRDSIQSHQESLSVLRSSNEFMR
YAVNVALQKVQQLKETGHVSGPDGQNPEKIFQNLCDITRVLLWRYTSIPTSVEESGKKEK
GKSISLLCLEGLQKIFSAVQQFYQPKIQQFLRALDVTDKEGEEREDADVSVTQRTAFQIR
QFQRSLLNLLSSQEEDFNSKEALLLVTVLTSLSKLLEPSSPQFVQMLSWTSKICKENSRE
DALFCKSLMNLLFSLHVSYKSPVILLRDLSQDIHGHLGDIDQDVEVEKTNHFAIVNLRTA
APTVCLLVLSQAEKVLEEVDWLITKLKGQVSQETLSEEASSQATLPNQPVEKAIIMQLGT
LLTFFHELVQTALPSGSCVDTLLKDLCKMYTTLTALVRYYLQVCQSSGGIPKNMEKLVKL
SGSHLTPLCYSFISYVQNKSKSLNYTGEKKEKPAAVATAMARVLRETKPIPNLIFAIEQY
EKFLIHLSKKSKVNLMQHMKLSTSRDFKIKGNILDMVLREDGEDENEEGTASEHGGQNKE
PAKKKRKK
NT seq 3987 nt NT seq  +upstreamnt  +downstreamnt
atggaccagaagattttatctctagcagcagaaaaaacagcagacaaactgcaagaattt
cttcaaaccctgagagaaggtgatttgactaatctccttcagaatcaagcagtgaaagga
aaagttgctggagcactcctgagagccatcttcaaaggttccccctgctctgaggaagct
ggaacacttaggagacgtaagatatacacttgttgtatccagttggtggaatcgggggat
ttgcagaaagaaatagcgtctgagatcataggattactgatgctggaggctcaccatttt
ccaggaccattattggttgaattagccaatgagtttattagtgctgtcagagaaggcagc
ctagtgaatggaaaatctttggagttactacctatcattctcactgccctggctacgaaa
aaggaaaatctggcttatggaaaaggtgtactgagtggggaagaatgtaagaaacagttg
attaacaccctgtgttctggcaggtgggatcagcaatatgtaatccaactcacctccatg
ttcaaggatgtccctctgactgcagaagaggtggaatttgtggtggaaaaagcattgagc
atgttctccaagatgaatcttcaagaaataccacctttggtctatcagcttctggttctc
tcctccaagggaagcagaaagagtgttttggaaggaatcatagccttcttcagtgcacta
gataagcagcacaatgaggaacagagtggtgacgagctattggatgttgtcactgtgcca
tcaggtgaacttcgtcatgtggaaggcaccattattctacacattgtgtttgccatcaaa
ttggactatgaactaggcagagaactcgtgaaacacttaaaggtaggacagcaaggagat
tccaataataacttaagtcccttcagcattgctcttcttctgtctgtaacaagaatacaa
agatttcaggaccaggtgcttgatcttttaaagacttcggttgtaaagagctttaaggat
cttcaactcctccaaggctcaaaatttcttcagaatctagttcctcatagatcttatgtt
tcaaccatgatcttggaagtagtgaagaatagcgttcatagctgggaccatgttactcag
ggcctcgtagaacttggtttcattttgatggattcatatgggccaaagaaggttcttgat
ggaaaaactattgaaaccagcccaagtctttctagaatgccaaaccagcatgcatgtaag
ctcggagctaatatcctgttggaaacttttaagatccatgagatgatcagacaagaaatt
ttggagcaggtcctcaacagggttgttaccagagcatcttctcccatcagtcatttctta
gacctgctttcaaatatcgtcatgtatgcacccttagttcttcaaagttgttcttctaaa
gtcacagaagcttttgactatttgtcctttctgccccttcagactgtacaaaggctgctt
aaggcagtgcagccccttctcaaagtcagcatgtcaatgagagactgcttgatacttgtc
cttcggaaagctatgtttgccaaccagcttgatgcccgaaaatctgcagttgctgggttt
ttgctgctcctgaagaactttaaagttttaggcagcctgtcatcctctcagtgcagtcag
tctctcagtgtcagtcaggttcatgtggatgttcacagccattacaattctgtcgccaat
gaaactttttgccttgagatcatggatagtttgaggagatgcttaagccagcaagctgat
gttcgactcatgctttatgaggggttttatgatgttcttcgaaggaactctcagctggct
aattcagtcatgcaaactctgctctcacagttaaaacagttctatgagccaaaacctgat
ctgctgcctcctctgaaattagaagcttgtattctgacccaaggagataagatctctcta
caagaaccactggattatctgctgtgttgtattcagcattgtttggcctggtataagaat
acagtcatacccttacagcagggagaggaggaagaggaggaggaagaggcattctacgaa
gacctagatgatatattggagtccattactaatagaatgattaagagtgagctggaagac
tttgaactggataaatcagcagatttttctcagagcaccagtattggcataaaaaataat
atctgtgcttttcttgtgatgggagtttgtgaggttttaatagaatacaatttctccata
agtagtttcagtaagaataggtttgaggacattctgagcttatttatgtgttacaaaaaa
ctctctgacattcttaatgaaaaagcgggtaaagccaaaactaaaatggccaacaagaca
agtgatagtcttttgtccatgaaatttgtgtccagtcttctcactgctcttttcagggat
agtatccaaagccaccaagaaagcctttctgttctcaggtccagcaatgagtttatgcgc
tatgcagtgaatgtagctctgcagaaagtacagcagctaaaggaaacagggcatgtgagt
ggccctgatggccaaaacccagaaaagatctttcagaacctctgtgacataactcgagtc
ttgctatggagatacacttcaattcctacttcagtggaagagtcgggaaagaaagagaaa
ggaaagagcatctcactgctgtgcttggagggtttacagaaaatattcagtgctgtgcaa
cagttctatcagcccaagattcagcagtttctcagagctctggatgtcacagataaggaa
ggagaagagagagaagatgcagatgtcagtgtcactcagagaacagcattccagatccgg
caatttcagaggtccttgttgaatttacttagcagtcaagaggaagattttaatagcaaa
gaagccctcctgctagtcacggttcttaccagtttgtccaagttactggagccctcctct
cctcagtttgtgcagatgttatcctggacatcaaagatttgcaaggaaaacagccgggag
gatgccttgttttgcaagagcttgatgaacttgctcttcagcctgcatgtttcgtataag
agtcctgtcattctgctgcgtgacttgtcccaggatatccacgggcatctgggagatata
gaccaggatgtagaggtggagaaaacaaaccactttgcaatagtgaatttgagaacggct
gcccccactgtctgtttacttgttctgagtcaggccgagaaggttctagaagaagtggac
tggctaatcaccaagcttaagggacaagtgagccaagaaaccttatcagaagaggcctct
tctcaggcaaccctaccaaatcagcctgttgagaaagctatcatcatgcaactgggaact
ctgcttacatttttccacgagctggtgcagacagctctgccatcaggcagctgtgtggac
accttgttaaaggacttgtgcaaaatgtacaccacacttacagcccttgtcagatattat
ctccaggtgtgtcagagctccggaggaattccaaaaaatatggaaaagctggtgaagctg
tctggttctcatctgacccccctgtgttattctttcatttcttacgtacagaataagagt
aagagcctgaactatacgggagagaaaaaggagaaacctgctgccgttgccacagccatg
gccagagttcttcgggaaaccaagccaatccctaacctcatctttgccatagaacagtat
gaaaaatttctcatccacctttctaagaagtccaaggtgaacctgatgcagcacatgaag
ctcagcacctcacgagacttcaagatcaaaggaaacatcctagacatggttcttcgagag
gatggtgaagatgaaaatgaagagggcactgcatcagagcatgggggacagaacaaagaa
ccagccaagaagaaaaggaaaaaataa

DBGET integrated database retrieval system